KEGG   Lachnoclostridium phytofermentans: Cphy_3404Help
Entry
Cphy_3404         CDS       T00619                                 

Definition
glycoside hydrolase family protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Cphy_3404
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Cphy_3404
Enzymes [BR:cpy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Cphy_3404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4166683..4168008)
Genome map
AA seq 441 aa AA seqDB search
MKALIYKSNETMRYQKSEVSFVENPRAEMNLIKLYPKETRQTIYGFGGAFTEAAAVTVAS
MSETSKKKVLDAYFSKDGHKYNFCRTHIQSCDFSLGNYAYVEDPEDKELKTFDLKRDHQY
LIPFIKDALTLNPSLILVASPWSPPGFMKSNGEMNHGGVLKKEYYQMWADMIVRYLKEYE
KLGINVQYLSVQNEPKATQTWDSCLYTGEEEGVFAAEYLRKTLDANGYPHVKIAIWDHNK
DCIIERTEETFAVPMARESVAAIAFHWYSGDHFEALQTVKEKYPEKELIFTEGCVEYSRF
KTNSQVKNAEMYLHDIIGNLNSGMNAYIDWNLVLNVDGGPNHVGNFCDAPVMYDKETDEL
DFKLSYYYLGHLSRFVTEGAKRFVVSRCTDKVEAVGFLNPDNSKVLVLMNRTEEDKVLQI
CEGNKVADIHLEAHSIMTICW
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttaatttataaaagtaatgaaaccatgagatatcaaaaaagcgaagtttcc
tttgttgagaatcctcgtgcagagatgaacctaatcaaactatatcctaaggaaacaagg
cagacaatctacggctttggtggtgcatttaccgaagcagcggcggtaaccgtagcttcc
atgagtgagacttcaaaaaagaaggtgttggatgcatatttttctaaggatggacacaag
tataacttttgtagaacacatatccaaagctgcgatttttcccttggtaattatgcctat
gtggaggatcctgaagataaagagctaaaaacctttgacttaaaacgtgatcatcaatac
ttaatcccatttatcaaagatgcgcttactctaaatccatcgcttatcttagtagcaagt
ccatggagtccgccaggatttatgaaaagcaatggtgagatgaatcatggtggtgtacta
aaaaaagaatattatcagatgtgggctgatatgatagtgcgttatcttaaagaatacgaa
aagctagggattaacgtacaatacttatcagtgcagaatgaaccaaaagctacacaaaca
tgggactcctgcctttatacaggggaagaagagggagtatttgcagcggaatatctgagg
aaaacactagatgcaaatgggtatcctcatgtaaaaatagcaatctgggaccataacaaa
gactgtatcatagaaagaacagaggaaacatttgctgtaccaatggcaagagaaagtgtc
gctgcgattgcatttcactggtattccggggatcattttgaagctttgcagaccgtgaag
gaaaaatatcctgaaaaagagcttatctttacagaagggtgtgtagaatattccagattt
aagacaaatagtcaagtgaagaatgcggaaatgtatcttcatgatatcatcggtaacctt
aattctggtatgaatgcctatattgactggaaccttgtattaaatgttgatggaggacca
aatcatgtaggtaacttttgtgatgctcctgttatgtatgataaggaaacggatgagctt
gattttaagttatcctattattatttgggacatttaagtcgttttgtaacagaaggtgcg
aaaaggttcgtggtatctcgctgtaccgataaagtggaagcggtaggatttctaaatcca
gataacagtaaggttttagtattgatgaatcggaccgaagaagataaggtattacaaatc
tgtgagggaaataaggtagcagatatccatttagaggcgcattcgattatgacaatttgt
tggtag

DBGET integrated database retrieval system