KEGG   Lachnoclostridium phytofermentans: Cphy_3511Help
Entry
Cphy_3511         CDS       T00619                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cphy_3511
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cphy_3511
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cphy_3511
Enzymes [BR:cpy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cphy_3511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4334543..4336042)
Genome map
AA seq 499 aa AA seqDB search
MNLLYQSTRDNHEQVTASQAILKGLASDGGLFVPTELPKLNISLEVLASMSYQQIAYEVM
KLFLTDFSEEELKHCITAAYDDKFDTKEIAPIKKSDGAYYLELFHGATIAFKDMALSILP
HLLTTAAKKNEVKEEIVILTATSGDTGKAALAGFADVPGTKIIVFYPKDGVSQVQEMQMV
TQKGDNAYVIGIHGNFDDAQTGVKEMFNNKELAKSLQDKGYLFSSANSINIGRLVPQVVY
YVYSYCRLLHAGELNKGEPLNVVVPTGNFGNILAAYFAKELGVPISKLICASNENKVLYD
FFTTGEYNRNREFILTSSPSMDILISSNLERLIYMISGETTEERAITNATLMNQLSKEGK
YEITPQMRQKLSDFIGGYAKEKETKAVIKRVYEKADYVIDTHTAVAASVYYNYKAASGDA
TKTLIASTASPYKFTRSVMEALEVETESKSDFELIDQLSEISKTKIPQAIEEIRTAPVIH
KMVCETEKMQEMVEKILRV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaatttactgtatcaaagtacccgtgataatcatgaacaggttacagcgtcccaggct
atcttaaaaggacttgcttcggatggtggactgtttgttccgaccgaattgccaaagctt
aatataagtctagaagtattagccagcatgagttatcaacaaatagcttatgaggttatg
aaactattcttaacggatttctctgaagaagaattaaaacactgcatcactgcagcttat
gatgataaatttgatacaaaagaaatagctccaatcaagaaatcggatggagcatattat
cttgaactatttcatggagctaccatagcatttaaagatatggcgctttctatattacct
cacttactaacgacagctgcaaagaagaacgaagtaaaggaagagattgtaatccttacg
gctacttctggtgatacaggaaaggcagctcttgctggatttgcagatgttcctggtaca
aagatcattgttttctatcctaaggatggagtaagtcaggttcaagaaatgcaaatggta
acacaaaagggtgataatgcctatgttatcggtatccatggaaacttcgatgatgcacag
actggtgtgaaagaaatgtttaacaataaagagcttgcaaagagcttacaggataagggt
tacttattctcatctgcaaactctattaatataggtcgtctggttcctcaagtagtatac
tatgtatattcttattgtcgtctacttcatgctggcgaattaaataaaggtgaaccatta
aatgttgtggtaccaaccggaaactttggtaatatactagcagcatattttgcaaaagaa
cttggtgttccgattagcaaattaatctgtgcttcaaacgaaaataaagtgttatatgat
ttcttcacaaccggagagtataatagaaaccgtgaattcatcttaacaagttcaccttct
atggacatcttaatctcaagcaatttagaacgtttgatatatatgatttccggagaaacc
actgaagaacgtgcaatcacaaatgcaacacttatgaaccaactctccaaagaaggtaaa
tatgaaatcactccgcagatgagacaaaaactctcggactttattgggggttatgcaaag
gaaaaagaaacaaaggctgttattaaacgtgtctatgagaaagccgattatgtcattgac
acacatacagctgtagctgcaagtgtatactataactacaaagcagcaagtggtgatgca
acaaagacattaatcgcttcaacggctagtccatataagtttactcgtagcgtgatggaa
gcattagaagttgagacagaaagcaagtctgattttgaattaatagatcagcttagtgaa
ataagtaaaacaaagatacctcaagctatcgaagaaattcgtaccgcacctgttattcat
aagatggtatgcgagacagagaagatgcaggagatggtggagaagatattgagggtataa

DBGET integrated database retrieval system