KEGG   Lachnoclostridium phytofermentans: Cphy_3678Help
Entry
Cphy_3678         CDS       T00619                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Cphy_3678
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cphy_3678
Enzymes [BR:cpy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Cphy_3678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4518411..4518959)
Genome map
AA seq 182 aa AA seqDB search
MGKITVTECGIDGLFVIEPTIFKDNRGYFIETYHKEAYEAAGITAEFIQDNQSMSKKGVL
RGLHFQINYPQAKLVRVLSGEVFDVAVDLRKGSKTFGKWYGVVLSEENQKQFFVPEGFAH
GYLVLSDTAVFAYKCTDFYHPGDDGGLLWNDPEVGIEWPIPEDMDLVIAQRDQEWGTLAD
IK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaataacagttacagaatgtggtattgatgggctatttgtaattgaaccaaca
atatttaaagacaatcgtggatactttatagagacgtatcataaagaggcatatgaagcc
gcagggattaccgcagagtttatacaggacaaccagtcaatgtcaaaaaagggagtacta
agagggcttcattttcaaatcaattacccgcaagcgaaactcgttcgtgtattaagtggt
gaggtttttgatgtggcagtagatcttcgaaaaggctccaaaacatttggtaaatggtat
ggtgtagtgcttagtgaagagaatcaaaagcaattttttgtaccagagggatttgcacat
ggatatttagtcttatctgatactgctgtgtttgcttataagtgtactgacttctatcac
ccgggtgatgatggtggactactttggaatgatcctgaggttggtattgagtggccaatt
ccagaagatatggatttagttattgcacaaagggatcaagaatggggaactttagccgat
ataaaatag

DBGET integrated database retrieval system