KEGG   Lachnoclostridium phytofermentans: Cphy_3843Help
Entry
Cphy_3843         CDS       T00619                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
cpy00260  Glycine, serine and threonine metabolism
cpy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpy01100  Metabolic pathways
cpy01110  Biosynthesis of secondary metabolites
cpy01130  Biosynthesis of antibiotics
cpy01230  Biosynthesis of amino acids
Module
cpy_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cphy_3843
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cphy_3843
Enzymes [BR:cpy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cphy_3843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABX44190
UniProt: A9KL41
Position
complement(4707224..4708408)
Genome map
AA seq 394 aa AA seqDB search
MKEGRFHQYGGQYVPETLMNAVLEVEKAYEYFKKDPDFCKELETLYHEYAGRPSLLYYAK
KMTEDLSGAKIYLKREDLNHTGSHKINNVLGQVLLAKKMGKTRVIAETGAGQHGVATATA
AALMGLECEIFMGKEDTDRQVLNVYRMELLGAKVHPVTSGTMTLKDAVNETMREWTKRVE
DTHYVLGSVMGPHPFPTIVRDFQKVIGKEIKAQLQEVEGKLPDAIVACVGGGSNAMGAFY
EFLNDPSVALYGCEAAGLGVNHPKNAATIANGTEGIFHGMKSYFCQDEYGQIAPVYSISA
GLDYPGIGPEHAMLHDTNRATYVPVTDDEAVEAFEYLSRTEGIIPAIESAHAVAYAKKLA
PTMGKDSILVINISGRGDKDVAAIARYRGVKLYD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaggaagatttcatcaatatggcggtcaatatgtaccagaaacattaatgaat
gcggtgttagaggtagaaaaggcatacgagtattttaaaaaggatcctgatttttgtaag
gaactagagaccttataccatgaatatgcaggaaggccatcgttgttatattacgctaag
aaaatgaccgaggatctttctggggctaaaatttacttaaagcgagaggatttaaatcat
acgggttctcacaaaattaataatgtactaggtcaggtattattggcaaaaaaaatgggt
aagacacgtgtcatagcagaaactggagccggccaacatggtgtggcgacagcaacagcc
gcagcacttatgggactggaatgtgaaatctttatgggaaaagaggacacagaccgacag
gtactgaatgtctatcgaatggaactattgggagctaaggtgcatccagtaacctcagga
actatgactcttaaggatgcagtaaacgaaacgatgcgtgagtggacgaagagggtagag
gatactcattatgttttagggtctgttatgggacctcatcctttcccaacaattgttcga
gattttcagaaagtgattggtaaggaaatcaaagctcaactacaggaagtggaaggaaaa
cttccagatgcaatcgttgcctgtgttggtggagggagtaatgctatgggagcattttat
gaattcctaaatgatcctagtgtagctttatatggttgtgaggcagcaggacttggtgta
aatcatcctaaaaatgcagctaccatcgcaaatggaacagaaggtattttccatggaatg
aaatcttatttctgccaggatgaatatggtcaaattgctcctgtttactctatttctgcg
ggtcttgattaccctggaatcggaccggagcatgctatgttacatgataccaatcgggca
acttatgtaccagttacggacgatgaagcggtggaggcatttgaatatctttcaagaaca
gaaggaattatacctgcaatagagagtgctcatgctgttgcatacgcaaagaagttagcg
ccaacgatggggaaagacagtatccttgtgataaatatctcaggacgtggagataaggat
gttgctgcgattgctagatataggggggtgaaattatatgactag

DBGET integrated database retrieval system