KEGG   Lachnoclostridium phytofermentans: Cphy_3915Help
Entry
Cphy_3915         CDS       T00619                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Cphy_3915
Enzymes [BR:cpy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Cphy_3915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4811136..4811726)
Genome map
AA seq 196 aa AA seqDB search
MSKIFVIMGKSATGKDTVYKKLIESKELMLKTAVGYTTRPIRKGERNGVEYRFVTVNEME
NLKEKGLIIEHRSYDTVHGEWHYFTVNDEQIIFGKNDYLLISTLEGFVQIRKYFGKDTVI
PIYIEVADDIRLERSIVRERKQESPKYAEVCRRYLADEEDFSEEKLMEANIIKRYKNVDL
NDCINEIVNDIKSFQI
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaatttttgtaatcatgggaaagagcgcgaccgggaaagatacggtctataaa
aagctgattgaatcgaaggagcttatgcttaagacagcggttggttatacaactagacca
attcgcaaaggggaaagaaatggcgtagagtatcgctttgtgaccgttaatgagatggaa
aatctaaaagagaaaggtctgattattgagcatagatcttacgatacggtacatggtgaa
tggcattattttaccgttaatgatgaacaaattatttttggtaagaatgattatcttctt
attagtacattagagggctttgtccaaataagaaaatattttggtaaggataccgtaatt
cctatttatattgaagttgcggatgacatacgattagaaagatcaattgttcgagagaga
aaacaagaaagtcctaagtatgcggaggtttgcagaaggtatctcgcagatgaggaggat
ttctcagaagaaaaattaatggaagctaatattataaaacggtataaaaatgtcgattta
aatgattgtataaatgaaatcgtgaatgatattaagagttttcagatataa

DBGET integrated database retrieval system