KEGG   Clostridium phytofermentans: Cphy_3925Help
Entry
Cphy_3925         CDS       T00619                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cpy  Clostridium phytofermentans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Cphy_3925
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cphy_3925
   00620 Pyruvate metabolism
    Cphy_3925
   00650 Butanoate metabolism
    Cphy_3925
  Lipid metabolism
   00071 Fatty acid degradation
    Cphy_3925
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cphy_3925
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cphy_3925
   00626 Naphthalene degradation
    Cphy_3925
Enzymes [BR:cpy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cphy_3925
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Cphy_3925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4821675..4824293
Genome map
AA seq 872 aa AA seqDB search
MTKKVELQTTGLVDSLEALTAKFRELKEAQELFATYTQEQVDKIFFAAAMAANQQRIPLA
KMAVEETGMGIVEDKVIKNHYAAEYIYNAYKDTKTCGVVEEDPSFGIKKIAEPIGVVAAV
IPTTNPTSTAIFKTLLCLKTRNAIIISPHPRAKNCTIAAAKVVLDAAVAAGAPAGIIGWI
DVPSLELTNEVMKNADIILATGGPGMVKAAYSSGKPALGVGAGNTPVIMDESCDVRLAVS
SIIHSKTFDNGMICASEQSVIISDKIYEAAKKEFKDRGCHICSPEETQKLRETILINGAL
NAKIVGQSAHTIAKLAGFDVAEAAKILIGEVESVELEEQFAHEKLSPVLAMYKSKSFDDA
VSKAARLVADGGYGHTSSIYINVGTGQEKIAKFSDAMKTCRILVNTPSSHGGIGDLYNFK
LAPSLTLGCGSWGGNSVSENVGVKHLINIKTVAERRENMLWFRAPEKVYFKKGCLPVALA
ELKDVMNKKKVFIVTDAFLYKNGYTKCVTDQLDAMGIQHTTYYDVAPDPSLASATEGAEA
MRLFEPDCIIALGGGSAMDAGKIMWVMYEHPEVNFLDLAMRFMDIRKRVYSFPKMGEKAY
FIAVPTSSGTGSEVTPFAVITDERTGVKYPLADYELLPKMAIIDADMMMNQPKGLTSASG
IDALTHALEAYASIMATDYTDGLALKAMKNIFAYLPSAYENGAADPVAREKMADASTLAG
MAFANAFLGICHSMAHKLGAFHHLPHGVANALLINEVMRFNSVSIPTKMGTFSQYQYPHA
LDRYVECANFLGIAGKNDNEKFENLLKAIDELKEKVGIKKSIKEYGVDEKYFLDTLDAMV
EQAFDDQCTGANPRYPLMKEIKEIYLKVYYGK
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaaaagtggaattacagacaactggattagtagactctctcgaagcattaaca
gcaaaatttagagagttaaaagaagcacaagagctctttgctacctacactcaagagcaa
gtagataaaatcttctttgctgctgccatggctgccaatcagcaacgtattccgttagca
aagatggctgtagaagaaacgggtatgggtattgtagaagataaagtaattaagaatcat
tatgctgcagagtatatttacaatgcatacaaagatacaaaaacatgtggagtggttgaa
gaagatcctagcttcggtatcaaaaaaattgcagagccaatcggcgtagttgcagctgta
atcccaactaccaatcctacctccactgctatctttaaaacattactttgtttaaagact
cgtaacgcaatcatcatcagcccacatcctcgtgctaagaactgtaccatcgcagctgct
aaggtagttttagatgctgcagttgctgcaggtgctcctgctggtataattggatggatt
gatgttccatcacttgaattaaccaatgaagttatgaaaaatgcagacatcatccttgca
actggtggacctggtatggtaaaggctgcttattcttctggtaaaccagcacttggtgtt
ggcgcaggtaatacccctgttattatggatgaaagctgcgatgttcgccttgcagtaagc
tctattattcactctaagacatttgataacggtatgatttgtgcttccgagcaatccgta
attattagtgataagatttatgaagctgctaagaaagaattcaaggatcgtggttgccac
atctgctccccagaagagactcagaagcttcgtgaaacaatcctaattaatggtgctctt
aacgctaaaattgttggacaaagcgctcatacgattgcaaagcttgcaggatttgatgta
gcagaagctgctaagattttaattggtgaagtagaatccgttgaactagaagaacaattt
gcacacgagaaactttctccagttcttgctatgtacaaatcaaaatcctttgatgatgca
gtaagcaaagctgctcgtcttgttgcagatggcggttatggccatacttcttccatctat
attaatgtaggtaccggacaagaaaagattgcaaagttttctgatgctatgaagacttgc
cgtattcttgtaaatacaccatcctcccatggtggtatcggtgacctttataactttaaa
ttagctccatctcttactcttggttgtggctcctggggcggtaactctgtatcagaaaac
gtaggagtaaagcacttaatcaacattaagacagttgctgagaggagagaaaacatgctt
tggtttagagcacctgagaaagtatactttaagaagggttgtttaccagtagccctcgca
gaattaaaagatgtaatgaataaaaagaaagtattcattgtaaccgatgctttcctttat
aaaaatggctatacaaaatgtgttactgatcagttagatgctatgggaattcagcatact
acttactatgatgttgctccagatccatctttagctagtgctacagaaggtgcagaagcg
atgagactcttcgagccagactgtattatcgcactcggtggtggttctgcaatggatgcc
ggaaagattatgtgggttatgtatgaacaccctgaagtaaacttccttgaccttgcaatg
cgtttcatggatattagaaagcgtgtttactccttccctaagatgggcgaaaaagcttac
tttatcgcagttccaacttcctccggtactggttctgaagttacaccatttgctgttatt
accgatgagagaactggcgtaaaatatccacttgcagattacgaattacttcctaagatg
gctattattgatgccgatatgatgatgaatcaacctaagggattaacttctgcttccggt
attgatgcccttacccatgcattagaggcatatgcttctatcatggctactgactatacg
gatggtttagcattaaaagctatgaagaatatcttcgcttaccttccaagcgcatatgaa
aatggtgccgctgatccggttgcaagagaaaagatggcagatgcttctaccttagctggt
atggcattcgcaaatgcattcttaggaatttgccactccatggctcataaattaggtgca
ttccaccacttaccacacggtgtagcaaacgcactcttaatcaacgaagtaatgcgcttt
aactccgttagcattcctacaaagatgggtactttctctcaataccaatacccacatgcg
ttagatcgttatgtagaatgtgcgaacttcttaggtattgccggaaagaacgacaatgag
aaattcgaaaaccttcttaaggcaattgatgaattaaaagaaaaagttggtatcaagaaa
tccatcaaagaatatggcgtagacgagaaatatttcttagatactttagatgctatggtt
gaacaggctttcgatgatcagtgtactggtgctaacccaagatatccattaatgaaggaa
atcaaggaaatctatcttaaagtgtactacggtaaataa

DBGET integrated database retrieval system