KEGG   Corynebacterium pseudotuberculosis PAT10: CpPAT10_0147Help
Entry
CpPAT10_0147      CDS       T01879                                 

Gene name
recR
Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
cpz  Corynebacterium pseudotuberculosis PAT10
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CpPAT10_0147 (recR)
DNA repair and recombination proteins [BR:cpz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CpPAT10_0147 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
150459..151115
Genome map
AA seq 218 aa AA seqDB search
MFEGPLQDLIDELSRLPGVGPKSAQRIAFHLLHVEPADIARLQDALGAVRDGVTFCRICC
NISRESVCRICADSGRDRGTICVVEEPKDIQVIERTGEYNGRYHVLGGALDPLANIGPRE
LNISTLLQRIGGVLPDRELADSTPDAPLYDSSPTVTEVILATDPNTEGEATASYLARLLR
DFPDLVVSRLASGMPLGGDLEFVDELTLSRALSGRLTI
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgaaggaccgcttcaggaccttattgatgagctttcacggctccccggcgtgggc
cctaaatctgctcaacgcatcgcttttcacttgcttcatgtggagcctgcggacatcgca
agacttcaggatgccctcggtgctgtccgagatggcgtgaccttttgtcgtatttgctgc
aatatctcccgcgaatcggtatgccgtatttgtgcggattctggccgggatcggggaacg
atctgcgtggtggaggaacccaaagatattcaggttattgagcggacgggcgaatataat
ggccgctaccatgtgctgggtggggcgttggatccgctagctaatattggtccccgtgaa
ctgaatatttctacgttgctgcagcgcattggaggggtgcttcctgatcgagagctagcg
gattctacgcctgatgcgccgctgtatgattcctctccgacggtgacagaggttattctt
gccaccgaccccaataccgagggtgaggcgacggcttcttatcttgcacgtctgctccga
gattttcctgatttggtggtttctcgtctggcttccggtatgcctttgggcggggaccta
gaatttgtggatgaactgacattgtcccgcgccctgagcggtcgattgacaatttaa

DBGET integrated database retrieval system