KEGG   Corynebacterium pseudotuberculosis PAT10: CpPAT10_0634Help
Entry
CpPAT10_0634      CDS       T01879                                 

Gene name
cysQ
Definition
3'-phosphoadenosine 5'-phosphate phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cpz  Corynebacterium pseudotuberculosis PAT10
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cpz00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(669315..670073)
Genome map
AA seq 252 aa AA seqDB search
MTAHFDDATLTKRLAQGTGEILKGVRNVGLLRGRELGDAGDDLAQNWIARVLEQHRPDDG
FLSEEAADNPERLGKDRVWIIDPLDGTKEFATGRQDWAVHIALVEDGTPTHAAVNLPDLG
VVFHTSEVRAVRGPYAKKIAVSHNRPPAVANHVAEKLSFTAEPLGSAGAKAMHVLLGDYD
AYIHAGGQYEWDSAAPVGVSLAAGLHCSRLDGSPLTYNNKDTYLPDLLVCRPELADDILS
MVAAFREENGSY
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgactgctcactttgacgacgcgaccctaaccaagcgacttgcccagggaacgggcgaa
atcctcaaaggggtaagaaacgtaggtcttttacgcgggcgtgaactaggcgacgccgga
gatgatctggcacagaactggattgcacgtgtgctggaacaacaccgacccgatgatgga
ttcctttctgaagaagccgcagataacccagaacgcctaggaaaagatcgtgtctggatt
attgatccgcttgacggcaccaaagagtttgccacagggcgccaagactgggctgtacac
atcgctttggtggaagacggaacgccgacccacgccgcagttaaccttcccgacttgggg
gttgtgttccatacctctgaagttcgtgcagtacgcggcccttatgccaagaagatcgcg
gtctctcacaaccgtcctcccgctgtagccaaccacgtcgctgaaaaactaagttttact
gctgagcctctcggttctgccggagcgaaagccatgcacgtgcttctcggcgactatgat
gcctacatccatgctggcggccaatatgagtgggactccgcagctcccgttggtgtcagc
ctagcggctggactgcactgctcgcgtctcgatggctccccgctgacttataacaacaaa
gacacctatcttccggatcttcttgtctgccgtcccgagcttgccgacgatatcctttcc
atggtggccgccttccgcgaggaaaacggctcgtactaa

DBGET integrated database retrieval system