KEGG   Corynebacterium pseudotuberculosis PAT10: CpPAT10_1123Help
Entry
CpPAT10_1123      CDS       T01879                                 

Gene name
gmk
Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cpz  Corynebacterium pseudotuberculosis PAT10
Pathway
cpz00230  Purine metabolism
cpz01100  Metabolic pathways
Module
cpz_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cpz00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CpPAT10_1123 (gmk)
Enzymes [BR:cpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CpPAT10_1123 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_16 RsgA_GTPase MMR_HSR1 AAA_25 AAA_22 NTPase_1 AAA_29 Cytidylate_kin CPT Rad17 ABC_tran
Motif
Other DBs
NCBI-ProteinID: AEK92460
Position
complement(1227677..1228252)
Genome map
AA seq 191 aa AA seqDB search
MTGDNPKGRLVVLAGPSAVGKSTVVHRLREEVPNLYFSVSMTTRAPRPGEVDGVDYFFVT
PEEFQSRIDGGEMLEWAEIHGGLQRSGTPAGPVEDALLAGRPVLVEVDLIGARNVAALKP
DAETVFLAPPSWEVLVDRLTGRGTEPEDVIKRRLETARQELASQDEFKHVVTNDKVDKTV
AEIRDILLGCC
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcgataacccaaaaggtcggctagtcgttttagctggtccatctgctgtggga
aagtccacggtggttcatcgccttcgcgaggaagtaccaaacctatattttagtgtctcg
atgaccacgagggctcctcgtcctggtgaagtcgatggtgtggattatttcttcgtgact
cccgaggagtttcagtctcgtatcgacggtggagaaatgctcgagtgggcagagatccat
ggtggactgcagaggtctgggactcccgcggggcctgtggaagacgcgttattggccggt
cgtcctgtgctggttgaagttgatcttattggtgctcgtaacgtcgcggcgttgaagcct
gatgcagagaccgttttcctagctccgccgtcatgggaagtccttgtagatcgtcttact
gggcgaggaacggagcccgaagacgtgatcaagaggcggctggaaactgcacggcaggag
ctagcatcccaggatgagtttaagcacgttgtaaccaacgataaagttgataagacggtc
gctgagattcgggatattctgctcgggtgctgctaa

DBGET integrated database retrieval system