KEGG   Corynebacterium pseudotuberculosis PAT10: CpPAT10_1299Help
Entry
CpPAT10_1299      CDS       T01879                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cpz  Corynebacterium pseudotuberculosis PAT10
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cpz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CpPAT10_1299 (dxr)
Enzymes [BR:cpz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CpPAT10_1299 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1422923..1424035)
Genome map
AA seq 370 aa AA seqDB search
MKLLRQIRSGFRSLELRRADAIPRAVIEQARILGLPAHAVAVADPQAAHAVSAALGNQIL
SGEDAATRLVQSIEADTVLNGLVGSLGLSATLATIESGENLALANKESLVAGGRFVTSKA
RPGQIIPVDSEHSAMAQCLRSGARSEVARFVLTASGGPFRGWTRQQMWDVTPQQAAAHPT
WSMGQMNTLNSATLVNKGLELIEATLLFDVPADHIDVTVHPQSIVHSMITFSDGATIAQA
SPPSMKLPISHALDWPARVPDAQPSLDFSSASSWDFMPVDNQAFPAIRLAREVALAGGTY
PAVYNAANEEAAAAFLAGRIRFPHIVDTVEEIVQNASDFAGEPHSVDEILAHEKEARRRA
NLFVDKLAQK
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
ttgaagttattgaggcaaatccggagcggtttcaggtcgttggaattgcggcgggcggac
gcgatcccgcgcgccgtaatagagcaggcaagaatattgggccttccggctcatgctgtt
gccgttgctgatcctcaagcggcgcatgctgtttctgcagcactcgggaatcagattttg
agtggggaagatgctgctaccaggcttgttcagagcatagaagctgacactgttttgaat
ggtttagtagggtcgctgggactctcagcaacattggccaccattgagagcggggagaat
cttgcgttggctaataaagagtccttggtagctggcgggagatttgttactagcaaagcg
cgtccggggcagattatccccgtggattctgagcactcggcgatggctcagtgtttgcgc
tctggggctcgttccgaggttgcgcggtttgtgctaaccgcttcaggtggaccgtttagg
gggtggactaggcaacagatgtgggatgtgactcctcagcaagctgcggcgcaccccacg
tggtcgatgggacaaatgaatacactaaactcggcgactttggtaaataaaggactggaa
ttaatagaagcaacattgcttttcgacgtccccgcagatcacattgacgtcacggtgcat
ccacagtcgatagtgcattccatgattactttttcggatggtgcgactatcgctcaggcg
tctcctccttctatgaaactgccgatttctcatgccttggattggccagcacgcgttcca
gacgcacagcctagccttgatttttcttctgcaagttcttgggattttatgcctgtggat
aatcaagctttccctgccattcggcttgcccgtgaagttgcactggcagggggaacctat
ccggcggtatataacgcggctaatgaagaagccgccgctgcttttcttgccggcaggatt
cggttccctcatatcgtggatactgttgaagaaatcgtccagaatgcttctgattttgcg
ggagagccacattccgtagacgagattttggcgcacgagaaagaagcccgacgtcgagca
aatctatttgtggataaactagctcagaaatag

DBGET integrated database retrieval system