KEGG   Corynebacterium pseudotuberculosis PAT10: CpPAT10_1347Help
Entry
CpPAT10_1347      CDS       T01879                                 

Gene name
trpC2
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cpz  Corynebacterium pseudotuberculosis PAT10
Pathway
cpz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpz01100  Metabolic pathways
cpz01110  Biosynthesis of secondary metabolites
cpz01130  Biosynthesis of antibiotics
cpz01230  Biosynthesis of amino acids
Module
cpz_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpz00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CpPAT10_1347 (trpC2)
Enzymes [BR:cpz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CpPAT10_1347 (trpC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh OMPdecase QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEK92680
Position
complement(1482046..1482867)
Genome map
AA seq 273 aa AA seqDB search
MGRVMPSVFEEIIAGVIEDVAARESVVSFKEIKARSRACEPPRDAIAALLNSGCGVIAEI
KRAAPDKGVLAEINSPVGLAKELVAGGASLIACQTERRRFHGSLSEMAEIRNVISVPIMC
RDFIVDPYQIHEARCYGADMVPLRVAALDQARMIALIDRIESLGMAALVEVRDTEEASRA
VAAGAKIIGVNARDFSTMTLNRLAFAEIAPGLPTDVIRVALSGVRNARELLDYAASGADA
VVVGEKIVTAADPCEATRSLVAAGQHPSCPSRG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgggacgggttatgccatcagtcttcgaagagattattgcgggcgtcattgaagatgta
gctgcgcgagaatcagtggtgtcgtttaaagagatcaaagcccgttcgcgtgcttgcgag
ccgcctcgggatgcaatagcggcgcttcttaatagtggttgtggcgtgatcgctgagatt
aaacgtgctgccccagataaaggcgttttagcagagatcaattctcctgttggcttagca
aaagaacttgtcgccgggggcgctagtttgattgcgtgtcagacggaacggcgaaggttc
cacggttcattatctgagatggctgagattcgtaatgtgatatcggtgccaataatgtgc
cgagacttcatcgtggatccctatcaaattcatgaggcgcgctgttatggagcggacatg
gtgcccttgcgcgtagctgctttagaccaagccaggatgattgcgcttatagatagaatc
gagtccctgggaatggcagcgctggtagaagtccgggatactgaggaagcatcgcgtgcg
gtggcagcgggtgcgaagatcataggggtaaacgcccgggatttctcaacgatgacgctc
aaccgcctggccttcgcagaaattgctcctggacttcccacagatgttattagagttgca
ttgtccggtgtgcgcaatgctcgtgaactcctggattacgctgcctctggtgcggacgcg
gtggttgtgggagaaaaaattgttactgctgcggatccgtgcgaagcgacgcgttcgttg
gtggcagcaggccaacatccatcgtgtccatcgcgaggataa

DBGET integrated database retrieval system