KEGG   Corynebacterium pseudotuberculosis PAT10: CpPAT10_1731Help
Entry
CpPAT10_1731      CDS       T01879                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cpz  Corynebacterium pseudotuberculosis PAT10
Pathway
cpz00480  Glutathione metabolism
cpz00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cpz00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CpPAT10_1731
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CpPAT10_1731
Enzymes [BR:cpz01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CpPAT10_1731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin
Motif
Other DBs
NCBI-ProteinID: AEK93056
Position
complement(1897032..1897505)
Genome map
AA seq 157 aa AA seqDB search
MTNFFDIPVTLNDATETTMNDWAGHCLMIVNTASRCGLTPQYEALEELYRDYAPRGFFVI
AMPCNQFAEEEPGTNKQIAEFCKREYGVTFPILEKADVNGENTHPLYQFLKGDGPDIEWN
FEKFVVSTEGKVVGRFAPNMEPDDLKIIECLEDNLVL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacttctttgatattccggtgacgcttaatgacgccaccgagacaaccatgaat
gattgggcagggcattgcctcatgatcgtgaataccgcatctcggtgtggtctgactcct
caatatgaagccctggaggagttgtatcgggattatgcgccacgcggattttttgtgatt
gcgatgccatgcaaccagtttgctgaggaagagcctggaaccaataaacagatagcagag
ttctgcaagcgggaatatggcgtgactttcccgattcttgaaaaggcagacgttaacggg
gagaacacacatccgctgtaccaattcttaaaaggagatggccccgatatcgagtggaac
tttgaaaagtttgtggtctcgactgaaggaaaggtcgtggggcggttcgctccgaatatg
gagccggatgatttgaagatcatcgagtgcttggaagacaacttggtgctttag

DBGET integrated database retrieval system