KEGG   Corynebacterium pseudotuberculosis PAT10: CpPAT10_1941Help
Entry
CpPAT10_1941      CDS       T01879                                 

Gene name
nagA
Definition
(RefSeq) Beta-N-acetylglucosaminidase
  KO
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cpz  Corynebacterium pseudotuberculosis PAT10
Pathway
Amino sugar and nucleotide sugar metabolism
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cpz00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CpPAT10_1941 (nagA)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    CpPAT10_1941 (nagA)
Enzymes [BR:cpz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CpPAT10_1941 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2125581..2126864)
Genome map
AA seq 427 aa AA seqDB search
MPLAGPESTSDTPITATMPTAMPITALAMVGPRVRRLRESDSKAIHVTIPWFTGWAMHMK
RLLAAALLGVLAACSDAGTNTDPTSTEATTALTTQETSAPASAKPQPEDVRAKAASLMMV
GVSNYDDALAALNQGAGGIFIGSGTDPNLLTAPDRNIQALRKAVGRDFSVSIDFEGGRVL
RHQGILGTFPSPQVMAQTMNPEQVRGMAKAMGDSLLAHGVTVNFAPVADIDAGLDVVGDR
AFSADPNIDAEYATAFAQGMLDAGVRPVFKHFPGHGRASGDSHTGQVFTPPLGDLENIDL
VPYGRINVPGAGVMLGHMVVPDLGAPQNGLPSTLNPAAYQLLRTGAYRDGRPFAGVVYTD
DLAMGAITGVMPIPQAVVASLQAGADQALWVTTAGLKEAIDATVAAVETGTYPRAQFEES
VRRVGVV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgccgttggctggcccagaatccacgagcgacacaccgatcacagccacaatgcccacc
gcgatgccgataacggcgctggctatggtggggccgagggtgcggcggttaagagaatcg
gattcaaaagccatacatgtaacaataccgtggtttactggatgggcaatgcacatgaaa
cgacttctcgccgccgccctcctcggtgtgctcgctgcatgtagcgacgccggaaccaat
acggatcccaccagcactgaggccaccactgcgttaacaacgcaggaaaccagcgcgcct
gcaagcgcaaaaccacagcctgaggacgtccgcgctaaagccgcgagcctgatgatggtg
ggcgtaagcaattacgacgacgcccttgctgccctaaaccaaggcgctgggggcatcttc
atagggtccggcaccgatcccaatcttctcaccgctccggatagaaacattcaggcgctg
cgtaaggccgtggggcgagacttttctgtctcgatcgattttgagggagggcgtgttctc
cggcatcagggaattctgggaaccttcccctcgccccaagtgatggcacaaaccatgaac
cccgagcaggttcgagggatggccaaagcgatgggcgactcattgctggctcacggagtg
accgtgaattttgctccggtcgcggatatagacgctggattagacgttgtgggcgatcgt
gcctttagcgcagacccaaatattgatgcggaatacgccacagcttttgcccaaggaatg
cttgatgctggggtccggccagtgtttaagcacttcccggggcatggccgcgccagtggc
gattcacacacaggacaggtattcacgccccctctaggtgacctggaaaacattgaccta
gttccttatggccggattaatgtccccggtgccggcgtgatgctcgggcatatggtggtt
cctgatctaggcgctccccagaacggacttccgtccaccctcaatccggccgcataccag
ttactacgcactggggcttatcgtgatgggcgtcctttcgccggcgtggtctacacggat
gatcttgctatgggagcaatcaccggggttatgcctatccctcaagccgtagtggcctcg
ctgcaagctggcgcagatcaggctttgtgggtgaccactgcggggcttaaagaagctatc
gacgctaccgtggctgccgtggaaaccggcacgtatcccagggctcaatttgaagagtcg
gtacgccgggttggtgttgtttaa

DBGET integrated database retrieval system