KEGG   Corynebacterium pseudotuberculosis PAT10: CpPAT10_1998Help
Entry
CpPAT10_1998      CDS       T01879                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
cpz  Corynebacterium pseudotuberculosis PAT10
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpz00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CpPAT10_1998 (deoA)
Enzymes [BR:cpz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     CpPAT10_1998 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2200763..2202064
Genome map
AA seq 433 aa AA seqDB search
MEGDTVAEKFDAVDVIRTKRDNGKLSKGQIDWIIDAYTRGIVGDDQMAALNMAIFLNGMD
REEIVQWTQAMIDSGETMSFASLSRPTTDKHSTGGVGDKITLPLAPLVASYGVAVPQLSG
RGLGHTGGTLDKLEAIPGWEADIDNARMMKILEDPGCVVCAAGAGLAPADKKIYALRDIT
ATVDCIPLIASSIMSKKIAEGTANLVLDVKVGSGAFMKELDQARELARTMVDLGRDARTN
MVALLTDMSVPLGRTIGNALEVRESVEVLAGGGPSDVIELTCALATEMLELAGVHDPDVH
EALADGRAMDSWKKMIRAQGGDPDAALPTARHTHEVTADRDGYLTEMDALALGVASWRLG
AGRARKEDPVQLGAGIEIHAELGEKVSKGQKLFTLHTDDEDRFSRALESLEPGVNIGDEP
PAPRPSVILDRIS
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtgataccgtggccgagaaattcgacgccgtagacgtcatccgcacaaagcgg
gacaacgggaagctaagcaagggacaaatcgactggatcatcgatgcctacactcgcggc
attgttggcgacgatcaaatggctgccctcaacatggcaatattcctcaacggcatggac
agagaagaaatcgtccagtggacccaggccatgatcgactccggcgagaccatgagcttt
gccagcctctcccggccaacaacagacaagcactccaccggcggggtcggcgataaaatc
acgcttccacttgcgccactcgttgccagttacggcgttgctgtgccacaactctctggt
agaggactaggacacacaggcggaaccctagacaaattagaggccatccccgggtgggaa
gctgacatagataatgcccgaatgatgaagatcctcgaagaccccggctgcgtggtatgc
gccgcgggagcaggcctcgcacccgccgacaagaagatctatgcgctgcgtgacatcact
gccaccgtcgactgcatcccactgatcgccagctccatcatgagtaaaaaaatcgccgag
ggaaccgcaaacctagtcctcgacgtcaaggtgggttccggggcctttatgaaggagctt
gaccaggcccgcgagctcgcccgcacaatggttgacctaggccgcgacgccagaaccaat
atggtcgcgcttctcaccgacatgtccgtccccctggggcgcaccatcggcaatgcccta
gaagttcgcgagtctgtagaggtcctcgcaggtggcggcccttccgacgtcatagagctc
acatgcgcccttgcgacggagatgcttgagctcgccggcgtccatgatcccgatgtccac
gaagcgcttgccgacggccgcgcgatggactcttggaagaagatgatccgcgcacagggc
ggcgaccccgacgcagcactccccaccgcacggcacacccatgaggtcaccgccgatcgc
gacggctatctcacagagatggacgccctcgcactgggagtagccagctggcgactcggc
gcaggacgcgcacgcaaggaagatccagtccaactcggcgcaggcatcgagatccatgca
gagctcggcgagaaggtatcaaaaggccagaagcttttcaccctccacaccgacgatgag
gaccgtttcagccgagccctagaatccctcgaacccggcgtaaatatcggcgatgagccc
ccggcacctcgcccctcggtcatccttgatcgcatcagctaa

DBGET integrated database retrieval system