KEGG   Corynebacterium pseudotuberculosis PAT10: CpPAT10_2076Help
Entry
CpPAT10_2076      CDS       T01879                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cpz  Corynebacterium pseudotuberculosis PAT10
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cpz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpPAT10_2076
Enzymes [BR:cpz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CpPAT10_2076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2292934..2293500)
Genome map
AA seq 188 aa AA seqDB search
MSSIPDMALGGSIRGGVPIIAPWFGKLMGHKELQHGWARRQKWEVLETSGGLDARMSHDD
WDLRLAVQSTPRGFAMMLKCRNASSVCRKLQLAFHPYFYVSDVLDTIVTAPGETFTTDGG
LLEEFRLSAPTPLLIDDGQRLITVKGQGTDHFIVWNPGEKLASEMSDMGTGEWRNFVCVE
PALLGEDS
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcattccagatatggcgttggggggttccattcgtggtggtgtgcccattatt
gctccgtggtttggcaaacttatggggcacaaggagctgcaacatggatgggcgcgccgg
cagaaatgggaggtgctagagacctcgggtgggctcgacgctcgaatgagtcatgatgat
tgggacttgcgtttggcagtccagtcgacgccgcgaggttttgccatgatgctgaaatgt
agaaacgcctcaagcgtttgccggaagcttcagttggcgttccatccatatttttatgtc
tctgacgttcttgataccatcgtgaccgcccccggtgagacctttactacggacggtggt
ttgttggaggaatttcgcctctccgctcccacgcctctgcttatcgatgacggccagcgt
ctcatcaccgttaaagggcaagggactgatcactttattgtgtggaaccctggcgagaaa
ctggcgagtgagatgtccgatatgggcactggggaatggcgaaactttgtctgtgtagag
cccgctctcctaggggaagactcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system