KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ000241Help
Entry
CpipJ_CPIJ000241  CDS       T01079                                 

Definition
ubiquitin carboxyl-terminal hydrolase 43
Orthology
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.1.2.15]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1083 aa AA seqDB search
MENAKNKDAQTKVDSSVPSSKSTGSSGGSKLKRAFSLSRNPFQSVVSGGRKATEKSGTMT
NASGVATSEQNSINSGGGGGNGHEPKLQGSSGGTTTERKIFRRLSVKKFINRIAQQMTYV
NLAGNHQKGGDRVPSAGPPANGFVWPADTTPGVIGLRNHGNTCFMNAVLQCLSHTDILAE
YFVLDQYKADLKRRNKINAKKFGTKGELTEQLALVLKSLWTCKDAPEYSSSFKAVVDRYG
SQFRSSTQHDAQEFLFWLLDKVHEDLNTASKRKYKTIKNNYGRSDEVIAAETLANHIRCN
NSFVQAVFQAQFRSSLTCPRCHKQSNTFDPFHCISVQLPQLTLQPVLVRVIYASQQPKQV
QLGLGVPHGSLVEGLREQLHADTGIAGERMILAEICESGFNRVYCDSHLVASVGDGDGTV
YCIESPVVGEGMTQIVLCISNARRDVGSGEVRRFGTPFCLVVSRDVSYVELQKLLLKEMS
GILKSEVFAFSTPVQEMFRMRLQDPSCDADAFLETSVEHPLFTEMIDLALSVLPTDAGPA
HVKLLIEWVNPERFFSDMTDPFVEHESVSQMKDKIPASSSLTLEQCLEHYTKAETLSAED
AWRCPHCQKYLPVVKTLGLWSLPDIMVIHFKRFRQQQLRGTQAAKLTTLVKFPLHGFDMT
PHLARELNAEASTGGTNGTTEDNWSPWRKTTKRNPVHQHSNNQFPHHMMDNRYDLYAVCY
HQGDTLETGHYTAACKNPYDANWYKFDDQRVNQVSSDRIQEEIVNNEAYILFYQRRKIDG
SECSGTSSSSGVDHWVSRIAAAPLGASVVEKSKEAVPVEVTPLPAVESPPAVVAVPKKAE
IEETTIMHSESESEISEEKTPVEEQQQPAEVVSEEPSANVQTVIVEVEAQVPVESPVKSL
PTTPTEEEEEESNKPIPMEQSEEESSIATLTEEPSSPELPEELSTTTTTSDMTTTTSDTT
TTRSPDSSSRFSLPTSHSHFQDILWRDNAATTVSEFIQQHQHHRPSSFTYKSYESDAVSM
IRGANTCSKDTLLFIDQHHQSHGGGLDRVVLDDESDMMPPPGSRALWISPVTPHKLITVS
PKN
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atggagaacgcgaaaaacaaagatgcccaaaccaaagtggactcatctgttccgtcgtcc
aaatcgactggttccagcgggggaagcaagctcaagcgggccttctcgctgtcccgcaac
ccgttccagtcggtcgtgagtggtggccggaaagctacggaaaaatccggaacgatgaca
aatgccagtggcgttgcgacctccgagcaaaattccatcaacagtggagggggaggcgga
aatggccatgagccaaagcttcaaggaagttccggtgggacgacgacggaacggaaaatc
ttccggcggctgtcggtgaaaaagttcatcaatcgcattgcacaacaaatgacatatgtc
aatcttgcaggcaatcaccaaaagggaggagaccgcgtgccgtccgcgggtccaccggcc
aacgggttcgtgtggcccgcggacacgaccccgggtgtgatcgggctgcggaaccacggc
aacacctgcttcatgaacgccgtcctgcagtgtctcagccacacggacattctggccgaa
tactttgttctagatcaatacaaggcggatctaaaacgacgaaacaagataaatgccaaa
aagttcggaaccaagggcgaactgaccgagcagctggcgctggtgctgaagtcgctgtgg
acgtgcaaggacgctcccgagtacagttcgagtttcaaggccgtggtcgaccgctacggg
agtcaattccggagttccacccagcacgatgcccaggagttcctgttctggctgctggac
aaggtgcacgaggacctcaacacggccagcaagcggaagtacaagacgatcaagaacaac
tacggccgctcggacgaggtgatcgcggcggaaaccctcgccaaccacatccgctgcaac
aattcgttcgtgcaggccgtctttcaggcccagttccggtcgtcgctgacgtgcccgcgg
tgccacaagcagagcaacacgttcgatccgtttcactgcatttcggtgcagctgccgcag
ttgacgctgcagccggtgctggtgcgggtgatttacgcctcgcagcaaccgaagcaggtc
cagctggggctgggggtgccacacggttcgctggtcgaggggttgcgggagcagctgcat
gccgacacgggtattgccggagagcggatgattttggcggagatttgcgagagcgggttc
aatcgggtttattgtgattcgcatttggtggcttcggtcggggacggggacggtacggtg
tactgcattgagagtccggtggtgggtgagggaatgacccagattgtgctgtgtattagt
aacgcgaggcgggacgttgggagtggcgaggtgcgacggtttgggacgcctttctgtttg
gtggtaagtcgggatgtgtcgtacgtggagttgcagaagctgctgttgaaggagatgagt
gggattttgaagtcggaggtgtttgcgtttagcacaccggtgcaggagatgttccggatg
cggttgcaagatccgtcgtgcgatgcggatgcctttttggagacgagcgttgagcatcca
ctttttaccgagatgattgatctggcgttgtcggtgctgcctacggatgctgggccggct
catgtgaagctactgattgagtgggtcaatccggaacggttctttagcgatatgaccgat
ccgtttgtggagcacgagagcgttagccagatgaaagacaagattccggcaagttcttcg
ctgacgctggagcagtgcctcgaacattacaccaaagctgagacgctttcggcggaagac
gcctggcgatgtccgcactgtcagaagtatctgccggtggtgaaaacgctcggattgtgg
tccctgccggacataatggtgattcactttaaacgtttccgccagcaacaactgcgcgga
actcaggctgccaaactgaccacgctggtcaaatttcccctgcacgggttcgacatgact
cctcatctggcacgagagctaaatgcagaggcatcgaccggtggaacgaacggcaccacc
gaagacaattggagcccgtggcggaaaacgaccaaacgtaacccggttcatcaacattcc
aacaatcaattcccgcaccacatgatggacaatcggtacgatctgtacgcggtctgctac
catcagggtgatacgcttgaaaccggacattacacggcggcctgtaaaaatccgtacgat
gcaaactggtataaatttgatgaccagcgggtgaaccaagtttcgtcggatcgcatccag
gaggaaatcgtcaacaatgaggcttacattctattctaccaaagacgcaagattgacgga
tcggagtgttccgggacgagttccagctccggtgttgaccactgggtctcgcgaatcgca
gctgccccactgggagcgtcggtcgtcgaaaaatcaaaagaagcggttcccgttgaggtc
acgccacttccagcggttgaaagtcccccagccgtcgtggccgttcccaaaaaggccgaa
attgaagaaaccacaatcatgcattccgaaagtgagagcgaaataagcgaggaaaagaca
cccgtcgaggagcagcagcagcctgccgaagtcgtcagtgaagaacccagtgcaaacgtg
caaacggtcatcgtcgaggtggaagctcaagttccggttgaatcgccggtaaaatcgttg
cccaccaccccaaccgaagaggaggaagaagaaagcaacaaaccaatcccgatggaacag
tccgaggaggagtcctcgattgcgaccctcacggaggaaccgtcctcgccggaactgccg
gaggagctgtccaccactacgaccacctcggacatgaccacaacgaccagtgacacaacc
accacgcggtcacccgactcgagcagtcggttctcgttgccaacgtcgcactcccacttc
caagacattctgtggcgggacaacgcggccacaaccgtgtcggagtttatccagcagcac
cagcaccatcggccatcgtcattcacgtacaaatcgtacgaatcggacgccgtctcgatg
atccgcggcgccaacacgtgcagcaaggacacgctgctcttcatcgaccagcaccaccag
tcgcacggaggtggactggaccgggtcgtgctcgatgacgagtcggacatgatgccaccg
ccgggcagccgggccctctggatatcgccagtcacgccgcataaactgataacggtctca
ccgaagaactaa

DBGET integrated database retrieval system