KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ000351Help
Entry
CpipJ_CPIJ000351  CDS       T01079                                 

Definition
UDP-glucuronosyltransferase 2B28
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CpipJ_CPIJ000351
   00053 Ascorbate and aldarate metabolism
    CpipJ_CPIJ000351
   00500 Starch and sucrose metabolism
    CpipJ_CPIJ000351
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    CpipJ_CPIJ000351
   00860 Porphyrin and chlorophyll metabolism
    CpipJ_CPIJ000351
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    CpipJ_CPIJ000351
   00982 Drug metabolism - cytochrome P450
    CpipJ_CPIJ000351
   00983 Drug metabolism - other enzymes
    CpipJ_CPIJ000351
Enzymes [BR:cqu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     CpipJ_CPIJ000351
Glycosyltransferases [BR:cqu01003]
 Others
  Hydrophobic molecule
   CpipJ_CPIJ000351
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 539 aa AA seqDB search
MQHFTSLLLTTLLLAFVPLATSSKILVLVPFPAPSHWLWLEHFVQELLERGHQVTAISNF
AAKERHPNYTEILIDPPFDIPYYFPVSDIFEAKYTSDLSNLLLYWNVGLTTTKFALENPN
VQQFIEQDDSVFDLVISEQFYQEAFLMFAHKYRAPIVTIGTLGYSDFMDRAMGLLTPWSF
VPHPILLYMDDMTFSQRCYNFLVSAVDALIRKYYYMPRQDKLAQKYFSAIEGPESFPSVY
ELEKSISVMLINSHVSTSPPRPSISGLVNVAGAHIQPAKPLPADIQRFLDGATEGAIFFS
LGSYVQSSDMPKDKLKAFFEVFRNLKQKVLWKFEDESMTNVPRNVMVRKWLPQSDILAHP
KVVLFITHGGMFGSQEGIFRGVPMLFIPFYGDQHRNALRAERAGYALTLNFADVNAITLG
SRINELLTNPAFNRLAKKASELFRDNLVPPMDEAMHWIEYVIRHKGAKHLKSISVDFNWV
QYLMLDVLTFFVIAILLTSFLVYHIIGAFLEKPTKHKSKDHKRPTVPPKVRTVKKVKAN
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcagcatttcacgtcgcttctgctgaccacgctgctgctcgcatttgtcccgctcgca
accagctccaagatactggtgctcgtccccttcccggcgcccagccactggctgtggttg
gagcacttcgttcaggaactgctcgaacggggccaccaggtgaccgcgatctcgaacttt
gccgccaaggagcgccaccccaactacaccgagatcctgatcgacccgccgttcgacata
ccgtactactttcctgtgtcagatattttcgaggctaaatacaccagcgatttgtccaac
ctgttactgtactggaatgtaggactcacgacgactaaatttgctttagagaatcctaac
gttcagcagttcatcgagcaggatgacagcgtgttcgacttggtcatctccgagcagttc
taccaggaagcatttctcatgtttgcccacaagtatcgagctccgatcgttaccatagga
accctaggatactcggactttatggatcgtgcgatgggtttgctgactccatggtcgttt
gtaccacatccaatactgctgtacatggacgacatgacgtttagtcagcgatgttacaac
ttcctggtatcagcagtagatgcgttgatccgcaaatactactacatgccccgacaggac
aaactggcccagaagtacttctcggcgattgaaggtcccgaatccttcccatccgtgtac
gagctggaaaagtccatctcggtaatgctgatcaacagccacgtctcaacttccccaccg
aggccgtcgatctcaggcctggtcaacgttgccggagcgcacatccaaccggccaagcca
cttccggcggacatccagcgatttctggatggagctaccgagggtgccatctttttcagt
ttgggatcgtacgtgcagagttccgacatgcccaaggacaaactgaaagcgtttttcgaa
gtttttcgcaatctcaagcagaaagtgctgtggaagttcgaggacgaatcgatgacgaac
gttccgcggaatgtgatggtccgaaagtggctgccacagagtgatattctagcccatcca
aaggtggttctcttcatcacccatggcggcatgtttggtagccaggaggggatcttccgt
ggagtccccatgttattcataccattctacggtgatcaacacaggaatgctcttagggcg
gaacgggccggctatgctctgacgttaaactttgccgacgtgaacgccatcacgctggga
tctcggatcaacgaacttcttacaaatccagcgttcaacagactagccaagaaagcatcg
gaactgttccgcgacaacctggtaccaccaatggacgaggccatgcactggatcgagtac
gtcatccgccacaaaggggccaaacatctcaagtccatctcggtggatttcaactgggtc
caatacttgatgctggacgttctaacattcttcgtgattgccattctactcacatcgttc
cttgtttaccacattatcggtgcatttctagaaaagccaacgaaacacaaatcgaaagat
cataaaaggccaaccgtccctcccaaagtcagaaccgttaaaaaagttaaagcgaattaa

DBGET integrated database retrieval system