KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ000351Help
Entry
CpipJ_CPIJ000351  CDS       T01079                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B28
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00040  Pentose and glucuronate interconversions
cqu00053  Ascorbate and aldarate metabolism
cqu00830  Retinol metabolism
cqu00860  Porphyrin and chlorophyll metabolism
cqu00980  Metabolism of xenobiotics by cytochrome P450
cqu00982  Drug metabolism - cytochrome P450
cqu00983  Drug metabolism - other enzymes
cqu01100  Metabolic pathways
Module
cqu_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CpipJ_CPIJ000351
   00053 Ascorbate and aldarate metabolism
    CpipJ_CPIJ000351
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    CpipJ_CPIJ000351
   00860 Porphyrin and chlorophyll metabolism
    CpipJ_CPIJ000351
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    CpipJ_CPIJ000351
   00982 Drug metabolism - cytochrome P450
    CpipJ_CPIJ000351
   00983 Drug metabolism - other enzymes
    CpipJ_CPIJ000351
Enzymes [BR:cqu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     CpipJ_CPIJ000351
Glycosyltransferases [BR:cqu01003]
 Others
  Hydrophobic molecule
   CpipJ_CPIJ000351
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C zf-H2C2
Motif
Other DBs
NCBI-GeneID: 6031178
NCBI-ProteinID: XP_001842021
VectorBase: CPIJ000351
UniProt: B0VZY7
AA seq 539 aa AA seqDB search
MQHFTSLLLTTLLLAFVPLATSSKILVLVPFPAPSHWLWLEHFVQELLERGHQVTAISNF
AAKERHPNYTEILIDPPFDIPYYFPVSDIFEAKYTSDLSNLLLYWNVGLTTTKFALENPN
VQQFIEQDDSVFDLVISEQFYQEAFLMFAHKYRAPIVTIGTLGYSDFMDRAMGLLTPWSF
VPHPILLYMDDMTFSQRCYNFLVSAVDALIRKYYYMPRQDKLAQKYFSAIEGPESFPSVY
ELEKSISVMLINSHVSTSPPRPSISGLVNVAGAHIQPAKPLPADIQRFLDGATEGAIFFS
LGSYVQSSDMPKDKLKAFFEVFRNLKQKVLWKFEDESMTNVPRNVMVRKWLPQSDILAHP
KVVLFITHGGMFGSQEGIFRGVPMLFIPFYGDQHRNALRAERAGYALTLNFADVNAITLG
SRINELLTNPAFNRLAKKASELFRDNLVPPMDEAMHWIEYVIRHKGAKHLKSISVDFNWV
QYLMLDVLTFFVIAILLTSFLVYHIIGAFLEKPTKHKSKDHKRPTVPPKVRTVKKVKAN
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcagcatttcacgtcgcttctgctgaccacgctgctgctcgcatttgtcccgctcgca
accagctccaagatactggtgctcgtccccttcccggcgcccagccactggctgtggttg
gagcacttcgttcaggaactgctcgaacggggccaccaggtgaccgcgatctcgaacttt
gccgccaaggagcgccaccccaactacaccgagatcctgatcgacccgccgttcgacata
ccgtactactttcctgtgtcagatattttcgaggctaaatacaccagcgatttgtccaac
ctgttactgtactggaatgtaggactcacgacgactaaatttgctttagagaatcctaac
gttcagcagttcatcgagcaggatgacagcgtgttcgacttggtcatctccgagcagttc
taccaggaagcatttctcatgtttgcccacaagtatcgagctccgatcgttaccatagga
accctaggatactcggactttatggatcgtgcgatgggtttgctgactccatggtcgttt
gtaccacatccaatactgctgtacatggacgacatgacgtttagtcagcgatgttacaac
ttcctggtatcagcagtagatgcgttgatccgcaaatactactacatgccccgacaggac
aaactggcccagaagtacttctcggcgattgaaggtcccgaatccttcccatccgtgtac
gagctggaaaagtccatctcggtaatgctgatcaacagccacgtctcaacttccccaccg
aggccgtcgatctcaggcctggtcaacgttgccggagcgcacatccaaccggccaagcca
cttccggcggacatccagcgatttctggatggagctaccgagggtgccatctttttcagt
ttgggatcgtacgtgcagagttccgacatgcccaaggacaaactgaaagcgtttttcgaa
gtttttcgcaatctcaagcagaaagtgctgtggaagttcgaggacgaatcgatgacgaac
gttccgcggaatgtgatggtccgaaagtggctgccacagagtgatattctagcccatcca
aaggtggttctcttcatcacccatggcggcatgtttggtagccaggaggggatcttccgt
ggagtccccatgttattcataccattctacggtgatcaacacaggaatgctcttagggcg
gaacgggccggctatgctctgacgttaaactttgccgacgtgaacgccatcacgctggga
tctcggatcaacgaacttcttacaaatccagcgttcaacagactagccaagaaagcatcg
gaactgttccgcgacaacctggtaccaccaatggacgaggccatgcactggatcgagtac
gtcatccgccacaaaggggccaaacatctcaagtccatctcggtggatttcaactgggtc
caatacttgatgctggacgttctaacattcttcgtgattgccattctactcacatcgttc
cttgtttaccacattatcggtgcatttctagaaaagccaacgaaacacaaatcgaaagat
cataaaaggccaaccgtccctcccaaagtcagaaccgttaaaaaagttaaagcgaattaa

DBGET integrated database retrieval system