KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ000732Help
Entry
CpipJ_CPIJ000732  CDS       T01079                                 

Definition
histone-lysine n-methyltransferase
Orthology
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cqu00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 585 aa AA seqDB search
MVKGRRTRQAATVGQVLAAATATTTDDTASPKRKDFKFDNNSPSQHFTNNNNNSQLLTNG
RKPAVEAMVLRGGRTKLNGIDRYFTSSGKPSSPGPTEQNVIDLTDDNTSESIAESPLMVL
GFAAAAVANSNPASNIFLQEPVLSLNIDKSCPAVGQSSRVIIKNSFFGTEMQTQFSPPKC
DPVWGGGGGGGVDVLKREPLDFALDLSKPTQVTEIDSTTFHDSSSCDSGDSGVVILPAIT
NIAAGGPLQFEPSTPGEGKRRKPATPHRIVCPSPVKSSSIVASPSSALSHLNIQSKRQPR
KNVKSKRRLHTKELENALEEAATSVPTNNSSVPEASPMLETGAGGAATATAAATLTGMLP
PAATVKPATLLQKQKQKKPVLNTAANPTALQNTNNNNQSRANSAAAAVAANKKVTDYFQV
RRSVRKTKKEVQWERDRDLERAIYEQRESGLTIVEFEGKGRGIVTTRKFARGEFVVEYIG
DLIDMAEAKLREQEYAEDDSTGCYMYYFKHQNVQHCIDATAESGKLGRLVNHSRNGNLMT
KTVLVNDLPHLVLLAKEDIPEGVEVTYDYGDRSKEALQHHPWLAF
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaaggacgccgcacccgtcaggcggccaccgttggccaggtgttggccgcagcg
acggccaccacaacagacgacaccgccagcccgaagcgtaaagattttaaatttgacaac
aacagcccttcccagcactttaccaacaataacaacaactctcaactactgaccaatggc
cgcaaaccggccgtcgaggcgatggtcctgcgcggtggacgaaccaaactgaacggtatc
gatcggtactttacgagcagcggaaaaccgtcctcgcccggaccgacggagcagaacgtg
attgacctaacggacgacaacacgtcggagtcgatcgccgagtcgccgctgatggtgctc
gggttcgccgccgccgccgtggccaacagcaatcctgcgagtaacatcttcctgcaggag
ccggtgctcagcttgaatattgacaaaagctgcccggcggttgggcagtcctcaagggtc
atcatcaaaaacagcttcttcgggacggagatgcagacgcagttttccccgccgaagtgt
gatccggtgtggggaggaggaggaggaggaggagtcgatgtcctcaagcgggaaccgttg
gactttgcgctggacctgtcgaagccgacccaggtcacggagattgattcgaccacgttc
cacgatagcagttcgtgcgacagcggagacagtggagtggtcatcctgcctgccatcacc
aatattgccgccggaggaccgttacagtttgaaccgtcgacgcccggggagggtaagagg
aggaaaccggccacgccgcaccgaattgtgtgcccttcgccagtgaagagctcgtcgatt
gtcgccagcccgtcgtctgcgttgtcacatctgaacatccagagcaagcggcaaccccgg
aagaacgtcaagtcgaagcggagactccacaccaaggaactggaaaacgccctcgaagaa
gcggcaaccagcgtgcctaccaacaacagcagcgttccggaagcctccccaatgctcgag
actggagccggaggagcagctaccgccaccgccgccgccactctcacgggaatgcttcca
cctgccgccaccgtcaagccagcgacgcttctccagaagcagaagcagaaaaagccggtg
ctaaacacggctgccaatccgacagctttacaaaacaccaacaacaacaaccaaagtcga
gcgaacagcgcggcagccgcagtcgccgccaacaaaaaggtcaccgactacttccaggtg
cgtcgcagcgtgcggaaaaccaagaaggaagtccagtgggagcgggaccgcgatctcgag
cgggcgatctacgagcagcgagagtccggactgacgattgtcgagttcgagggcaagggc
cgaggcatcgtgaccacgcgaaagtttgcccgcggggagtttgtcgtcgagtacatcggc
gatctgatcgacatggccgaggcgaagctgcgcgagcaggagtacgccgaggacgacagc
acgggatgttacatgtactacttcaagcaccagaacgttcagcactgcatcgacgccacc
gccgagagtggcaagctgggccggttggtgaaccactcgcggaacggcaacctcatgacc
aaaaccgtgctggtgaacgacctgccgcacctggtgctgcttgccaaagaggacatcccc
gagggcgtcgaggtgacgtacgattacggcgaccggtcgaaggaagccctgcagcaccac
ccgtggctggcgttctag

DBGET integrated database retrieval system