KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ000778Help
Entry
CpipJ_CPIJ000778  CDS       T01079                                 

Definition
phospholipase c
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Phototransduction - fly
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:cqu00562]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:cqu04310]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:cqu04070]
Organismal Systems; Sensory system; Phototransduction - fly [PATH:cqu04745]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1069 aa AA seqDB search
MAHSKLDLCDDMDQPMSHYFINSSHNTYLTGHQLTGKSSVEIYRQSLLAGCRCVELDFWN
SRTEEPVIVHGYTFVPEICAKDVLEAIAETAFKTSDFPVILSFENHCNPRQQAKIANYCR
DIFGDMLLDRPLDSHPLESGLDLPPPAALKRKIIIKNKKKHHHHHHHHKKGGGQGGTGGV
TSPTAAAMAGAAGAIAPGVAGQTNAAAAVSNNGAANTTSAMATAAASLITTGSGSFSAAA
GASLQLQQSTQQQQQEENTSSAPPSPLPLASSTTTTTNGNINNSTSTTNATTQAIVTGNG
DVTHHAPPLQQIRQSSKESTGSSDTDSSSDDESMPGAVVGPIGSTEADKVPQTKETEAGA
EISALVNYVQPVHFSSFENSEKKARYYEMSSFDEKQATTLLKERPIEFVNYNKRQLSRVY
PAGTRFDSSNFMPQLFWNAGCQLVALNYQTLDLAMQLNLGLFEYNYRCGYMLKPEFMRRK
DRRLDPFAESTVDGIIAGTVIVTVLSGQFLTDKKVGTYVEVDMFGLPADTVRKKFRTRIV
RDNGINPCYGEEPFVFKKVVLPELASIRIAAYEEGGKLIGHRVLPVIGLCPGLRHLTLRT
EVGQPITLATLFLSIVVKDYVPDGLSELAEALANPIKYQSELEKRSEQLAVLQEDMEPIE
EDSCPRKDTLKTSDNVTGSPKHRTSIQPPSTTGATESSTDHERETPLEVISKVVALPVAQ
SSVDRTSPMLVKQVTIQQQPTTIQEKHDSKGHTTAGADHTISKIVADPLEKIFEDKQVRK
KRDALEKELKALKKSHDKEKMKLTSQKSGDLTDGIKKSKFGMGNKLVKRFSSKNMADMNI
RIPPCVNPDGDNACDNSAHAERLKQVCRDHASSYRDVLEKYHEVIYNLADDLLRQSQENQ
MKQMKTNMERETSEVMRQLQLSRKNEVKQLAQVHKDKDELERMKREVDSTLVEKGVAERV
RLTATYERKRDELQRQHDLVKQGLDDHRAKAKAMLDKEAESHACISETFLAHLNTSASTT
SCSSVATLPTTSLSSGNLCGSAAGGGTITKSVSTSSTNAHGNNVNNTHA
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atggcccacagcaagctggacctgtgcgacgatatggatcagccgatgtcgcactacttt
atcaactcgtcgcacaacacctacctgaccgggcaccagctgacggggaaaagttccgtc
gagatctaccgccagagtttgctcgccgggtgcagatgcgtcgagctggacttttggaac
agccgcaccgaggagccggtgatcgtccacgggtacacgttcgtgccggagatttgcgcc
aaagacgtactagaagcaatagctgaaacagcattcaagacatccgattttcctgtgata
ttgagtttcgagaaccactgcaacccgaggcagcaggccaaaatagcaaactactgtcgt
gatatttttggagatatgttactagataggcccttagattcccacccgctcgagtccggc
ctggatctgccgccgccggcggccctcaagcgaaaaatcatcattaagaataagaagaag
caccaccaccaccatcatcaccacaaaaaagggggcggccaaggcggcacgggtggcgtg
accagtccgacggcggcggcgatggccggggccgccggtgccattgcaccgggtgtggcc
ggacaaacgaacgccgccgccgccgtcagcaataatggagcagccaacaccacgtcggcg
atggccacggcagcggccagtctcatcaccaccggcagtggcagcttcagtgcagcagcc
ggtgcaagcttacaactgcaacagagcacacagcagcagcagcaagaggaaaacacttcc
agtgcaccaccgtcaccgctaccactagcatcaagcaccaccaccacaaccaacggcaac
atcaacaatagcacaagcaccaccaacgcaacaacacaagcaatagtgaccggaaacggg
gacgtgacgcaccatgcacctccactgcagcaaatccgtcaaagttcaaaggaaagcacc
ggctcgtcggacacggacagctcgagcgacgacgagtcgatgccgggggccgtggtcggc
ccgattggatccaccgaggcggacaaggtgccgcagaccaaagagactgaagcgggcgcg
gagatttccgccctcgtcaactacgtgcagccggttcactttagcagttttgaaaactcc
gagaaaaaggcccgttactacgagatgtcgtcgttcgacgagaagcaagcgaccaccctg
ctgaaggagcgcccgatcgagttcgtcaactacaacaagcgccagctgtcgcgagtctat
ccggcggggacacgcttcgacagctccaactttatgccccagttattctggaacgccggc
tgccaactggttgcgctcaactaccaaacccttgatctcgcgatgcagctcaacctgggc
ctgttcgagtacaactaccggtgcgggtacatgctgaagccggagtttatgcgccgcaag
gaccgccggctggacccgttcgccgagagtacggtcgacggcatcatcgctggtacggtg
atcgtgaccgtgctgtcggggcagtttctgacggacaagaaggtcggcacgtacgttgag
gtggacatgtttggcctgccggcggacacggtgcggaaaaaattccgaacacggatcgtg
cgcgataacgggatcaatccgtgctacggtgaggagccgttcgttttcaagaaggtggtg
ctcccggagctggccagcattcggatagcggcgtacgaggagggtgggaagctgatcggg
caccgggtgctgccggtgattggactgtgtcccgggctgaggcatctgacgttgaggacc
gaggtgggacagccgattacactggcgacgttgtttctttcgattgtcgtgaaggattac
gttccggatgggttgtccgagctggcggaagcgcttgccaatccgatcaagtaccagagc
gagctggagaagcgctcggaacagctggcggtgctgcaggaggacatggaaccaatcgag
gaagattcatgtccgcggaaggatacgctgaagaccagtgacaacgtgaccggaagtccc
aagcaccggacgagcatacaaccgccgtcgacgaccggcgccacggaaagcagcacagac
cacgagcgggaaaccccgctggaggtgatctccaaggtggtggcccttcccgtagctcag
tcctccgtcgacaggaccagcccaatgctggtgaagcaagtcacaatccaacagcagccc
acgacaatccaggaaaagcacgacagcaaaggacacacgacggccggcgcagatcacacc
atcagcaaaatcgtagccgacccgttggaaaagatctttgaggacaaacaggtccgcaag
aagcgggacgccctggagaaagaactgaaagcactgaaaaagagtcacgacaaggaaaag
atgaagctcacctcgcagaaaagtggcgacctaaccgacggcatcaaaaagagcaaattc
ggcatgggcaacaagctggtgaagcggttcagcagtaaaaacatggccgacatgaacatc
cggataccgccgtgtgtcaatccggacggggataatgcgtgtgataatagtgcgcatgcc
gagcggctcaagcaggtttgtcgcgaccacgcgagcagctatcgggacgtgttggaaaag
taccatgaggtgatttacaacctggccgacgatttgctgcggcagtcgcaggagaaccag
atgaagcagatgaagaccaacatggagcgcgaaacgagcgaggtgatgcgacagctccaa
ctttcacgaaaaaacgaagtcaaacagctagcccaggtgcacaaagacaaggacgagttg
gaaagaatgaaacgcgaagtggactccacgctagtggaaaagggcgtggccgagcgggtc
cggctgacggccacgtacgaacgcaaacgggacgagctgcagcggcagcacgacctcgtc
aagcagggcctcgatgatcatcgggcgaaggccaaagcgatgctcgacaaggaggcggaa
tctcacgcgtgcatttcggagacgttcctggcccatctcaacacgagtgcgagcacgacc
agctgctcgtcggtggccacgctacccaccacatccctgtccagtgggaatctgtgcggc
agtgcagctggcggtggcaccatcaccaaatcggtctcgacctcgtcgacgaacgcgcac
ggaaacaacgttaacaatactcacgcctag

DBGET integrated database retrieval system