KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ001043Help
Entry
CpipJ_CPIJ001043  CDS       T01079                                 

Definition
palmitoyl-protein thioesterase 1
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CpipJ_CPIJ001043
  Lipid metabolism
   00062 Fatty acid elongation
    CpipJ_CPIJ001043
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    CpipJ_CPIJ001043
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     CpipJ_CPIJ001043
Lipid biosynthesis proteins [BR:cqu01004]
 Fatty acid synthase
  Component type
   CpipJ_CPIJ001043
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 299 aa AA seqDB search
MKTFGAIGALIVLLAVQASGDNVTSPGLPIVMWHGMDDTCCFPFSLGGFKKFLEAELGVY
VKSLEIGNSIVTDYKSGYLIHPNRQVEDVCNQLNGDPQLANGYNAIGFSQGGQFLRAIAQ
RCPTPRMNNLITLGGQHQGVFGLPDCPSISSKTCEYFRQLLNYAAYASWVQNYLVQATYW
HDPLNEQAYKESSTFLADINNERTVNETYIENLQQLNKFVMVKFTKDKIVQPIESQWFGY
YKPGQDRETQKLEESELFLKNRLGLQEMQQRNKLVFLECPGNHLQFTKDWFKQNIYPFL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgttcggtgctattggtgccttgatagtactgttggctgtacaggcaagcggg
gataacgtaacaagtccaggactccccattgttatgtggcacggaatggacgatacctgt
tgcttcccgttcagtttgggcggcttcaaaaagttcctggaggccgagcttggcgtttac
gtcaagtcgctggaaatcggcaactcaatcgtaaccgactacaagagcggctatctaatt
cacccaaataggcaggtggaagacgtctgcaatcagctcaacggcgacccccagttggcc
aacgggtacaacgcaataggattctcacaaggcggacagtttctacgcgccattgctcag
cgctgcccaacgcctcgcatgaacaatctgatcactctcggcggccagcatcagggcgta
tttggactgcctgactgtccctcgatcagcagcaaaacatgcgagtacttccggcagctg
ctgaattatgccgcgtacgcaagctgggtgcagaattacctggtccaggccacctactgg
cacgatcccttgaacgagcaggcgtacaaagagtccagcacgttcttggcggacatcaac
aatgagcggacggtcaacgaaacgtacatcgaaaatctgcagcagctgaacaagtttgtg
atggtcaagtttaccaaggataaaattgttcaaccgatcgagtcccaatggttcgggtat
tacaaacccggacaagatcgggaaacccaaaagttggaagagtcggagctgtttctgaag
aaccgcctcggactgcaagagatgcagcagcgaaacaaacttgtgttcctggaatgtcct
ggcaaccatctgcagttcacaaaggactggttcaagcagaacatctacccattcttgtaa

DBGET integrated database retrieval system