KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ001206Help
Entry
CpipJ_CPIJ001206  CDS       T01079                                 

Definition
histone acetyltransferase Tip60
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 458 aa AA seqDB search
MDVDEAVQSICESTASLSEGCRLPVRMTGTNDWPLAEIISIKEQAEDGNTWYYVHYVDFN
KRLDEWVMEEYLDTRKVQFPRKDGLTTGQNTGVTTPKRIPPIGERSRPASPIHSPDIVNG
SAVLAAALQKKINRKRKATSTENEDSQEVPTTPTPRQSGSMVTHGHDDVVTRMKNVQLIE
LGQHRIKPWYFAPYPQEMCTMTCIYICEFCLKYRKSRKCLERHIKKCNLRHPPGNEIYRK
QTISFFEIDGRKNKSYAQNLCLLAKLFLDHKTLYYDTDPFLFYVMTEFDSRGFHIVGYFS
KEKESTEDYNVACILTMPPYQRKGYGKLLIEFSYELSKFEGKTGSPEKPLSDLGLLSYRS
YWAQTILEILILAKPTGDNEKPQITINEICELTSIKKEDVISTLQILNLINYYKGQYIIC
INKETIDQHRKAMEKRKIRIDSKCLHWTPKDWSKRSKW
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggacgtggacgaggccgtgcagtcaatctgtgaatcgacggcttccctgtctgaagga
tgtcgcctgccggttcgaatgaccggaaccaacgattggccactggcggagattatcagc
atcaaagagcaggccgaggacggtaacacctggtactatgtgcactacgtggacttcaac
aaacggttggacgagtgggtcatggaggagtatttggacactcggaaggtacaattccca
cggaaggatggcctcacgactggtcagaacactggcgttacaacaccgaagcggataccg
cccatcggggaacgttcccggccggcaagtccaatccattcgccggacattgttaacggc
agtgcggtgttggcggccgccttgcagaagaaaatcaaccgcaaacgaaaggccacctcc
acagagaacgaagactcgcaggaagttccgacgacgccgacgcctcgacagtccggaagt
atggtgacgcacggtcacgacgacgttgtgacgcgaatgaaaaacgttcaactgattgag
cttggtcagcaccgcatcaagccgtggtactttgcgccatacccccaagaaatgtgcacc
atgacctgcatctacatctgcgagttctgcctcaagtatcgcaagagtcgaaaatgcctc
gaaaggcacatcaaaaagtgcaacctgcgacatccgccggggaacgaaatctaccgcaag
caaacgatcagttttttcgagattgacgggcgcaagaacaagagctacgcgcagaacctg
tgtctgctggcgaagctgttcctggaccataaaacgctctactacgacaccgatccgttc
ctgttctacgtgatgacggagttcgactcgcggggtttccacattgtgggctatttttcc
aaggagaaggaaagcacggaagattacaacgtggcgtgtattctgacgatgccgccgtac
cagcgcaaaggctacggcaaactgttgatcgagtttagttatgaattatccaaattcgaa
ggcaagactggatcccccgaaaaaccgctatccgatttgggactgctttcatatcgaagc
tactgggcgcaaacaattttggaaattctgattcttgcaaaaccgaccggcgacaacgag
aaaccgcagataacaatcaatgaaatttgtgagttgaccagcatcaagaaggaggatgta
atttcaacgttgcagatcctaaacttgataaactactataagggccagtacataatctgc
ataaataaagaaacaatcgatcagcaccggaaagcgatggagaaacgaaagatccggatt
gattccaagtgtctccactggacgcccaaggactggtccaagcgttccaagtggtag

DBGET integrated database retrieval system