KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ001265Help
Entry
CpipJ_CPIJ001265  CDS       T01079                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cqu00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 564 aa AA seqDB search
MIHWKVALLCTLVVASSARQIVQKSEEGHEREHYHRSSNLHVKPVKQAFTEAELESKYWN
DAAQESLGAKLKKEEVSKVAKNIIFFIGDGMSPQTVAATRMYLGNENEQLSFEKFPYLGQ
AKTYCVNRQVADSACTGTAYLSGVKINYGMLNVAASVPRYDCDYEKTNETEIFGIMKWAQ
DAGKATGIVTNTRITHASPAASYAQSATRGWEYDVEVRAAGCDQEKTMDIAQQLVRNEVS
KNFKVAMGGGRRYFLPRDVNDGEGARGYREDGKNLVEEWLETHKEMGESEFVWNREQLLA
VDPKKTEYLLGLFEASHMKFNLVVEEQNAQDMEPTLAEMVEAAVKVLQESEEGFVLFVEG
GLIDLAHHDTMARMALDETAEYSKAIEHARKLTSEDDTLIVVSSDHSHTMTYNGYPTRGN
DILGIGDVSDRDRLPYTTLSYANGPGYGVTYNVANVAERLDISEYDFTRYNQRYLATVPL
GSETHGGEDINVYASGPFAHLFVGNYEQSTLPHLMAYAGNFGEFYREIEEDKDKEDDDDD
AGSSLVVSVPVVLIAVIVGLLMRP
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgattcactggaaggtagcgctgttgtgtacgttggtggttgcgagcagtgctcggcaa
attgttcaaaaatccgaggagggtcatgaacgagagcactatcacagatcgagcaatctc
cacgtgaaaccggtcaagcaagctttcactgaagcggagcttgagtccaagtattggaac
gatgctgctcaagaatcgctgggagcaaaattgaagaaggaagaggtgagtaaggtggcg
aagaacatcatcttcttcatcggcgatggtatgtccccgcaaacggtggccgcaactcgg
atgtacctcgggaacgagaacgagcagctgtcgtttgaaaagttcccgtacttgggacaa
gccaagacgtactgcgtgaaccgacaggttgcggactcggcttgcaccgggacggcgtac
ctgtccggcgtgaagatcaactatgggatgctgaacgtggcggcgtcggttccgaggtat
gactgcgactacgagaagaccaacgagacggagatattcggcatcatgaagtgggcccag
gacgctgggaaggcaacgggaattgtgacgaatacgcggataacgcacgcatcgccggcg
gcgagttacgcgcagagtgccacaaggggatgggagtacgatgtggaggtgcgtgctgca
ggatgcgatcaggagaagacgatggacattgctcagcagttggttcgcaacgaggtgtcg
aagaactttaaggttgcgatgggtggtggcaggcgatactttctaccgcgtgacgtcaac
gatggagagggagctagaggatacagggaggacggcaagaatctggttgaggaatggttg
gagacgcacaaggagatgggagagtcggagtttgtatggaatcgcgagcagctgcttgcg
gtggatccgaagaagacggagtatttgctggggctgttcgaggctagtcatatgaagttc
aacctggtggttgaagagcagaacgctcaggacatggagccaacgcttgcagagatggtt
gaggctgccgtcaaggtgctgcaggaaagcgaggaaggattcgtgctgttcgtcgaggga
ggactgatagatctggctcatcacgacaccatggcccgaatggcgctggacgaaacggcc
gagtattccaaagccattgaacacgccaggaagttgaccagtgaggacgatacgttgatt
gtcgtcagttcggatcacagtcacacgatgacctacaacgggtatccgactcgtggcaac
gacatcctcggcatcggcgacgtcagcgatcgggaccgtcttccgtacaccaccctgagt
tacgccaacggtcccgggtacggcgtgacgtacaacgtggccaacgtggccgagcgcctg
gacatctcggagtacgatttcacgcggtacaaccaacgctacctggcgacggttccgctg
gggtcggaaacgcacggtggagaggacatcaacgtgtacgcgtcgggaccgtttgcccat
ctgttcgtggggaactacgagcagagcacgctgccccatctgatggcgtacgcgggtaac
tttggcgagttttaccgggagattgaggaggacaaggacaaggaggacgacgatgacgat
gcgggaagctcgctcgtggtgtcggttccggtagttttgatagcggttattgtggggcta
ctgatgaggccctaa

DBGET integrated database retrieval system