KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ001268Help
Entry
CpipJ_CPIJ001268  CDS       T01079                                 

Definition
(RefSeq) NADH-cytochrome B5 reductase
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CpipJ_CPIJ001268
Enzymes [BR:cqu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     CpipJ_CPIJ001268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 6032305
NCBI-ProteinID: XP_001842937
VectorBase: CPIJ001268
UniProt: B0W2L8
AA seq 321 aa AA seqDB search
MSDFDVVPVAVGVLVVVAGALLANYLLKKDKSKSGGGKSSGGDAKKAASSQLRTLMDPQE
KYMLPLIEKEELSHDTRRFRFGLHSGEHVLGLPVGQHIHLSATINEELVIRAYTPVSCDD
DKGFVDLVVKVYKKGVHPKFPEGGKMSQHLESLAIGDRIAFRGPSGRLQYLGGGKFSIKK
LRKDPAQIYEADKVSLIAGGTGITPMLQLVREVLKKADSDKTQLSLIFANQTEDDILLKP
ELDDLAARYPEQFKLWYTLDRPNPDWTQGKGFITDEMIKEHLFAPSPSTLVLMCGPPPMV
NYACIPALEKLGYQMDRTFAY
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtccgattttgatgtcgtccccgtggcggttggcgtactggtggtcgtagccggtgcc
ctcctcgccaactacctgctgaagaaggacaaatccaagtccggcggtggaaaatccagc
ggcggcgatgccaagaaggcggcctcgtcccagctgcgtacgctgatggacccgcaggaa
aagtacatgcttccgctgattgagaaggaggagctgtcgcacgatacgcggcggttccgg
ttcgggttgcactcgggagagcacgtgctggggctgcccgttggtcagcacatccacctg
tcggcgacgatcaacgaggagctggtgattcgggcgtacacgccggtgtcctgcgacgat
gacaagggctttgtggatctggtggtgaaggtttacaagaagggagtgcatccgaagttc
ccggagggtggcaagatgtcgcagcacttggagagcttggccattggggacaggattgcg
ttccgtggaccgtcggggcggttgcagtacctgggtgggggcaagttttcgattaagaaa
ctgcggaaggacccggctcagatctacgaagctgataaggtcagcttgattgccggtgga
actggaattacgccgatgttgcagctggttcgcgaagttctgaagaaggctgactccgac
aaaactcaactgtcgctgatctttgccaatcaaaccgaagacgacattctcctcaagccc
gagctggacgacctggccgcgcgctaccccgaacagttcaagctgtggtacacgctggac
cgtcccaaccccgactggacccagggcaagggcttcatcacggacgagatgatcaaggag
catctgtttgccccctccccgtcaacgctggtcctgatgtgcggcccaccgccgatggtc
aactacgcgtgcattccggcgctcgagaagctgggctaccaaatggatcgtaccttcgcc
tattaa

DBGET integrated database retrieval system