KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ001343Help
Entry
CpipJ_CPIJ001343  CDS       T01079                                 

Definition
histone acetyltransferase type B catalytic subunit
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CpipJ_CPIJ001343
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 391 aa AA seqDB search
MTAINSLQNFVTSALDCTRFRLIREDADFEEEAAAFHPEMAHQIFGEQENIFGYRDLQID
VCFAAGPLDIYFNIKYSKKVDDVNTEGIKADDVEKSLAALVEDGCYYTNLDEYKKVIKAR
SAAFKPFGTKVDEFEVNPGASARTFEVYVSDITDQEFLKFHSRLESFSFWFIDAFSRVEH
DPLWLFFIVYEKYSNNNNEVRYATAGYFTVYQYYSYPEFIRPRISQILVLPPFQKLGIAS
RLIEHTTYNYFVTKKNVADITYEEPTDIVQHIRSVVDAKRKDMLAEAKEKFKINPKQCRV
IYEILRLAVTDTKNDAEYRNYRLEVKKRLNLNYSKHRRELLRLQKRGVDVDGAFSILPSL
EDRISQLNAEYKQEVESVYYQVLKKLQLVRD
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgacggccatcaacagtttgcagaactttgtgaccagcgcgctggactgcacccggttc
cggttgatccgggaggacgccgactttgaggaggaggcggccgcgttccatccggagatg
gcgcaccagatcttcggcgagcaggagaacatcttcggctaccgggacctgcagatcgac
gtgtgcttcgcggcgggtcctctggacatttacttcaacatcaagtactcgaaaaaggtt
gacgacgtcaacaccgagggcatcaaggcggacgacgtggaaaaatcgctcgccgcgctc
gtcgaggacggctgctactacaccaacctggacgagtacaaaaaggtcatcaaggcgcgg
tcagcggcgttcaaaccgttcggcaccaaggtggacgagttcgaggtcaacccgggagcg
tcggcacgcaccttcgaggtgtacgtgagcgacatcaccgaccaggagttcctcaagttc
cactcgcggctggagtcgttctcgttctggttcatcgatgccttcagccgggtcgagcac
gatccgctctggctgttcttcatcgtgtacgagaagtactccaacaacaacaacgaggtt
cggtacgccaccgcaggttacttcaccgtttaccagtactactcgtacccggagtttatc
cggccgcgcatcagccagattctggtgctgccaccgttccagaagctcggaatcgcctcc
cggttgatcgaacatacgacctacaactacttcgtcaccaaaaagaacgtcgcggacatc
acctacgaggagcccaccgacatcgtccagcacatccgctccgtcgtggacgccaaacgc
aaggacatgctcgcggaggcgaaggaaaagttcaaaatcaaccccaaacagtgccgcgtc
atctacgagattctgcgcctcgccgtcaccgacaccaagaacgacgccgagtaccgcaac
taccggctcgaggtgaagaagcggctcaacctgaactacagcaagcaccggcgcgagctg
ctgcggctgcagaagcgcggcgtcgacgtggacggggcgttcagcatcctgcccagcctg
gaggaccggatcagccagctgaacgcggagtacaagcaggaggtggaatccgtctactat
caggtgctgaaaaagctgcagctggttcgcgattaa

DBGET integrated database retrieval system