KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ001546Help
Entry
CpipJ_CPIJ001546  CDS       T01079                                 

Definition
(RefSeq) profilin
  KO
K05759  
profilin
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    CpipJ_CPIJ001546
Membrane trafficking [BR:cqu04131]
 Others
  Actin-binding proteins
   Others
    CpipJ_CPIJ001546
Cytoskeleton proteins [BR:cqu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     CpipJ_CPIJ001546
Exosome [BR:cqu04147]
 Exosomal proteins
  Proteins found in most exosomes
   CpipJ_CPIJ001546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 126 aa AA seqDB search
MSWQDYVDNQLLASQCVSKAAIAGHDGGVWAKSEGFEVSKEELAKIVQGFDKTELLTSGG
VTLAGQRYIYLSGTDRVIRAKLGKMGVHCMKTQQAVIVSIYEEPVQPQQAASIVEKLGDY
LITCGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaggattatgttgacaatcagctcctggcttcccagtgcgtatcgaaagcg
gccatcgccggtcacgatggtggcgtttgggccaaatcagaaggattcgaggtgtcaaaa
gaagaactggcgaaaatagtgcaaggcttcgacaaaaccgaactgcttacctcaggcggc
gttaccctggccggccagcgttacatctatctgtccggcaccgaccgagtgattcgggcc
aagctgggcaagatgggcgtccactgtatgaagacacagcaggctgttatagtttcaatt
tacgaagagccagttcagcctcagcaagcggcatctatagtcgaaaagcttggagattat
ctgattacctgtggttattag

DBGET integrated database retrieval system