KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ001546Help
Entry
CpipJ_CPIJ001546  CDS       T01079                                 

Definition
profilin
Orthology
K05759  
profilin
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Exosome [BR:cqu04147]
 Exosomal proteins
  Proteins found in most exosomes
   CpipJ_CPIJ001546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 126 aa AA seqDB search
MSWQDYVDNQLLASQCVSKAAIAGHDGGVWAKSEGFEVSKEELAKIVQGFDKTELLTSGG
VTLAGQRYIYLSGTDRVIRAKLGKMGVHCMKTQQAVIVSIYEEPVQPQQAASIVEKLGDY
LITCGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaggattatgttgacaatcagctcctggcttcccagtgcgtatcgaaagcg
gccatcgccggtcacgatggtggcgtttgggccaaatcagaaggattcgaggtgtcaaaa
gaagaactggcgaaaatagtgcaaggcttcgacaaaaccgaactgcttacctcaggcggc
gttaccctggccggccagcgttacatctatctgtccggcaccgaccgagtgattcgggcc
aagctgggcaagatgggcgtccactgtatgaagacacagcaggctgttatagtttcaatt
tacgaagagccagttcagcctcagcaagcggcatctatagtcgaaaagcttggagattat
ctgattacctgtggttattag

DBGET integrated database retrieval system