KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ001555Help
Entry
CpipJ_CPIJ001555  CDS       T01079                                 

Definition
choline/ethanolamine kinase
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CpipJ_CPIJ001555
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     CpipJ_CPIJ001555
    2.7.1.82  ethanolamine kinase
     CpipJ_CPIJ001555
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 498 aa AA seqDB search
MRDIAARICRDYLTGAWKTIPAEDLQLRRISGGLSNFLYYVSLPEDHQQRSDTPRSNYSS
GSSSSKRARKDSYSSMLEPKEVMLRIYGQTHGEHALETMLTESVVFTLLSERKLGPKLHG
IFPGGRIEQYIPARALKTAELGDSKISLKVAEKMAAIHSLDIPVSKEPDWLWSTMNRWLN
SMESTLKTLEKDQANDNKAIAGQEIITRLDFRAEVEWLKSVIEREDHPIVFSHNDLQEGN
ILLREDCSPASVVEGFCTLDQFDESTQLGSHFSSILISNSTSSSNSGSVASLKSNGVDRA
SVGGEVVVHHEDCNKNSRKRSMCENIESELDNTRDSVLSGNSQALSDQPCDGEPQLMIID
FEYCAYNYRGFDLANHFLEWTFDYTKPDGPFYYHKPEQFPTAEQQDKFIAVYLEKSSCCG
EAAPSAEDIAEVRREVQCFTLASHLFWSFWAIVNMYQEIEFGYLEYAVCRLNEYVKAKKQ
YSELINNSGNSPTKDSEK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgacattgcggcgcggatttgccgggactacctgaccggtgcgtggaagaccatt
ccggccgaggacctgcagctgaggcgaatcagcggcggcctgtcgaactttctttattac
gtcagcctgcccgaggaccatcagcagcgaagtgacacgccccggtccaattattctagc
ggcagcagcagctccaagcgggcccgcaaggacagctactcgagcatgctagagccgaag
gaggtaatgctccgcatctatggtcaaactcatggcgagcacgcactggaaaccatgctt
accgagtcggttgtattcacacttttgagcgaacgaaaactaggtccaaaactgcacggc
atcttcccaggtggcagaatcgagcagtacattccggcacgtgcgttgaaaacagccgag
ttgggtgattcgaaaatttcattgaaggttgcggaaaaaatggccgcgattcacagtttg
gacattccggtttccaaggagcccgattggctgtggagcacgatgaaccgctggctgaac
agcatggagagcacgctgaagactttggaaaaggatcaagcaaacgacaataaggcgatt
gctgggcaggaaattatcacgaggctagattttcgagcggaagtcgagtggctcaagtcg
gtcatcgagagggaggaccacccgatcgttttctcgcacaatgacctgcaggagggtaac
atcctgttgcgggaagactgttctccggcgagtgtcgtggaaggtttttgcaccctggat
caattcgatgaatccacgcagttaggctcacactttagctcaattttaatttccaattcc
actagcagcagcaacagtggcagtgtggctagccttaaatccaacggtgtcgatcgtgca
tccgttggcggtgaagtggtagttcatcacgaagactgcaacaaaaattctaggaagcga
tccatgtgtgaaaacattgaaagtgagctggacaacacgagagactcggtgctcagtgga
aattcccaagctctctcggaccaaccctgtgatggcgaaccgcaacttatgattatagat
tttgaatattgtgcctacaactatcgcggattcgatttggcaaatcactttctcgagtgg
acgttcgattacaccaaaccagatgggcctttctactaccacaagccggagcagtttccc
accgcagagcaacaggacaagttcattgcagtttatttagagaaatctagctgctgcggg
gaagcggccccgagcgccgaggacattgcggaagttcgacgagaagtgcagtgcttcact
ttggcatcgcatctgttctggagcttctgggccatcgtgaacatgtaccaggagattgag
tttggatacctggaatatgcagtttgccgactgaacgagtacgtaaaagctaagaagcag
tactcggagctgatcaacaactcgggaaattcacccaccaaggacagcgagaagtaa

DBGET integrated database retrieval system