KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ001655Help
Entry
CpipJ_CPIJ001655  CDS       T01079                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpipJ_CPIJ001655
   00052 Galactose metabolism
    CpipJ_CPIJ001655
Enzymes [BR:cqu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     CpipJ_CPIJ001655
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 432 aa AA seqDB search
MSASASVDSKRSSYGTGAGDGSQRDASTVTVRTMDGGQHAEQESVALTVDGFGTVKNPLT
GVVEPVKRFTWVNESGMSVQVISYGAIITSVKVPGRDGSLDDVVMGFDDIPGYQTANNPY
FGATVGRVANRVGGAKFTIDGVEYLVTKNWENRHQLHGGKIGFDKFNWASYVNGTVVTLT
HTNPEGHEGYPGAVLTSVTYQLTNDNKFLVKFQATSSHPTPINLTNHSYFNLAGHATGHE
EVYRHIITLNADRITETDEDSIPSGNFLCVGGTPYDLRIPRELGPAMSRAPGEGYDNNFC
ITKGTEQGLAFTARVVHPRSGRFLEVYTDQPGVQLYTSNGMPDPNRNIRPRAINAPDYYE
VTHLEPVVPAMTSDPPIRGKGGAKYFKHGAFCLETQNFPDAINHANFPNSVLVPGETYSH
EVVYKFGIYEEN
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcatcggccagcgtagattccaagcggtcctcgtacgggaccggtgccggcgat
ggaagccagcgggacgctagcaccgttacggtgcggaccatggacggagggcagcacgca
gagcaggagtcggtcgcgttgaccgtggatgggttcggaacggtgaagaatccgttgacg
ggagtggtggaaccggtgaagcggttcacgtgggttaatgagagtgggatgtcggtgcag
gtcatttcgtacggggcgatcattacgtcggtgaaagttcctgggagggatggatcgctg
gatgacgtggtgatggggttcgatgacattccggggtaccagacggcgaataatccttat
tttggggcgacggttggtcgcgttgcgaatcgggttggaggagcgaagtttacgattgat
ggggttgagtacctggtgacgaaaaactgggagaaccgacaccagctgcacggcgggaag
attgggttcgacaagttcaactgggcgtcatatgttaacgggacggtcgtcacgttgacc
cacacgaacccggagggacacgagggatatccgggagcggttctaacgtcggtcacgtat
caactgacgaatgacaacaagtttttggtaaagttccaagcgacctccagccatccgacg
ccgatcaacctgacgaaccattcctacttcaatctggccggtcacgccaccggccacgag
gaggtctaccggcacatcattacattgaacgcggatcgtatcaccgaaacggacgaggat
tcgattccgagcgggaatttcctgtgcgtgggtggaacaccgtacgatttgcgcatccct
cgcgagctgggaccggccatgtcgcgggctcctggtgaaggttacgacaacaacttctgc
atcaccaagggcacggagcagggactggcgtttacggcgcgggtcgtgcatcctcggtct
ggccggttccttgaagtgtacacggaccaacccggcgttcagctgtacacgagcaacggt
atgccggatccgaatcggaatatccgtccccgagcaatcaacgctccggactactacgag
gtgacccatctggaaccggtggtgccagcgatgacctcagacccaccgatccgcggcaag
ggcggtgcaaagtacttcaagcacggtgccttctgtctggaaacgcaaaacttccccgac
gccatcaaccacgccaacttccccaactcggttctggtcccgggcgaaacttactcacac
gaggtcgtctacaagtttggaatctacgaggagaattga

  All links  
No link information was found.   
DBGET integrated database retrieval system