KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ001900Help
Entry
CpipJ_CPIJ001900  CDS       T01079                                 

Definition
(RefSeq) aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00010  Glycolysis / Gluconeogenesis
cqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpipJ_CPIJ001900
Enzymes [BR:cqu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CpipJ_CPIJ001900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim SLC12 DDHD DUF1510 CDC45 SAGA-Tad1 Neur_chan_memb CDK5_activator SID-1_RNA_chan GPCR_chapero_1 TFIIA Presenilin Rtf2 DUF572 LMBR1
Motif
Other DBs
NCBI-GeneID: 6033199
NCBI-ProteinID: XP_001843677
VectorBase: CPIJ001900
UniProt: B0W4P3
AA seq 363 aa AA seqDB search
MLSRYSTAQFGPWNFGPQHGFARVVRWTLERSPERLPSGDMEAVFSLMDNEITRSMWNYP
FRITYRLILREKELHFHIGVYNPSKDITFSFNLLLHTYLKVPDVRRCQITGLHGCTFIDK
TRDGAIYQEGRDVVTINEWTDRIYQHTPQEHVITNVVSGRKMRLQKYNFPDTVVWNPWMD
KARECQDFGDDEYPNMICVEAGHVSTPVILLPGTAFEASQILQQNQQNQQNQPQSSSQQQ
NQTTQSNQSSHQQTSHQQQQQQQQQSQSLAQSSQAAAVAAAAAAAQQQQAAAVQQQQQQQ
QQQQQAAVQQLWQVPAAAAAAAACWNNYANFQTAGVLAFKMPPSCGGLCGPQNNCELCSL
NSN
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcccgctactccacagcccagttcggcccgtggaacttcgggccccagcacggg
ttcgcccgggtcgtccggtggacgctcgagcggtccccggagcgactgccgagcggtgac
atggaggccgtgttcagccttatggataacgaaatcacccgatccatgtggaactatccc
ttccgcatcacgtaccgactgatcctgcgcgagaaggagctccacttccacatcggcgtg
tacaacccgagcaaggacattacgttctcgttcaacctgctgctgcacacgtacttgaag
gtgccggacgtgcgccggtgtcagatcaccggcctgcacgggtgtacctttatcgataag
actagagacggtgctatctaccaggagggtcgcgacgtggtgacaatcaacgaatggacg
gatcggatctaccagcacacgccccaggagcacgtcatcacgaacgtggtgtcgggccgg
aagatgcggctgcagaagtacaactttcccgacacggtggtgtggaacccctggatggac
aaggcccgggagtgccaggactttggcgatgacgagtacccgaacatgatctgcgtcgag
gctggccacgtgtccacgccggtgatcctcctgcccggaaccgcgttcgaggcgagtcaa
atacttcagcaaaaccagcagaatcagcagaaccagccacagtcgtcgagccagcagcaa
aatcaaacgacacaaagtaatcagtccagtcatcagcaaaccagtcaccaacaacagcag
cagcagcaacagcagagccaaagcttggcccagtccagtcaagcggcggccgttgccgct
gccgcagctgccgcccagcaacaacaggcggccgccgtgcaacagcagcagcagcagcaa
cagcagcaacaacaggctgccgtgcagcagctgtggcaggtgccggcggcggccgcggct
gcagcggcctgctggaacaactacgccaacttccagacggctggtgtgctggccttcaag
atgccaccgtcctgtgggggtctttgcgggccccaaaacaactgcgagctgtgctcgttg
aactccaactga

DBGET integrated database retrieval system