KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ001987Help
Entry
CpipJ_CPIJ001987  CDS       T01079                                 

Definition
phosphatase-1
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:cqu03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 347 aa AA seqDB search
MKGTYPPLFWEVVMVGTFHPLGHAVGRPVGVHSLRGCRPGKAVPMSEEEIRGLCLKSREI
FLQQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETIC
LLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKLWKTFTDCFNCLPIAAII
DEKIFCCHGGLSPDLNHMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVKGWGENDRGVSF
TFGVDVVSKFLGMHDLDLICRAHQVVEDGYEFFAKRSLVTLFSAPNYCGEFDNAGGMMSV
DENLMCSFQILKPSEKKAKYQYTGTNAQRPQTPQRNQNQPLPPTKRK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtacttatccccccctcttctgggaggtggtcatggtgggcacgttccaccca
cttggacacgccgtcggacggccagttggagttcacagtctcagaggatgccggccgggc
aaggccgtaccgatgtcggaggaggagattcgaggactgtgcctgaagtcgcgtgaaatt
ttcctgcagcagccgatcctgctcgagctggaagccccactcaaaatctgcggtgacatc
cacggccagtacacagacctgctgcggctgttcgagtacggtgggttcccgccggaggcc
aactacctgttcctcggcgactacgtggaccggggcaagcaatcgctcgagacgatctgt
ctgctgttggcctacaaaatcaaatacccggagaactttttcctgctgcggggcaatcac
gagtgtgccagtattaataggatatacggattctacgacgagtgcaaacgaaggtacaac
gtcaagctgtggaaaaccttcaccgactgtttcaactgcttaccgattgcggccatcatc
gacgagaagatcttctgctgtcacggcggactcagtccggacctgaaccacatggagcaa
atccgacgaatcatgcgaccaacggacgttcccgacactggactgctgtgcgacctgctg
tggagcgatccggacaaggatgttaagggctggggcgagaacgaccgcggcgtcagcttc
acgttcggcgtcgacgtcgtgtccaagttcctggggatgcacgacctggatctgatctgc
cgggcgcaccaggtcgtcgaggacgggtacgagttctttgcgaagcggtcgctcgtgacg
ctcttttccgcgcccaactactgcggcgagtttgacaacgccggcggcatgatgtccgtg
gacgagaacctgatgtgttcgtttcagattctgaaaccgtcggagaagaaggccaaatac
cagtacaccggcacgaacgcccagcggccgcagacgccccagcggaaccagaaccagccg
ctgcccccgaccaaacggaaataa

DBGET integrated database retrieval system