KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ001987Help
Entry
CpipJ_CPIJ001987  CDS       T01079                                 

Definition
phosphatase-1
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    CpipJ_CPIJ001987
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     CpipJ_CPIJ001987
Protein phosphatases and associated proteins [BR:cqu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     CpipJ_CPIJ001987
Transcription machinery [BR:cqu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     CpipJ_CPIJ001987
Spliceosome [BR:cqu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    CpipJ_CPIJ001987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 347 aa AA seqDB search
MKGTYPPLFWEVVMVGTFHPLGHAVGRPVGVHSLRGCRPGKAVPMSEEEIRGLCLKSREI
FLQQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETIC
LLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKLWKTFTDCFNCLPIAAII
DEKIFCCHGGLSPDLNHMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVKGWGENDRGVSF
TFGVDVVSKFLGMHDLDLICRAHQVVEDGYEFFAKRSLVTLFSAPNYCGEFDNAGGMMSV
DENLMCSFQILKPSEKKAKYQYTGTNAQRPQTPQRNQNQPLPPTKRK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtacttatccccccctcttctgggaggtggtcatggtgggcacgttccaccca
cttggacacgccgtcggacggccagttggagttcacagtctcagaggatgccggccgggc
aaggccgtaccgatgtcggaggaggagattcgaggactgtgcctgaagtcgcgtgaaatt
ttcctgcagcagccgatcctgctcgagctggaagccccactcaaaatctgcggtgacatc
cacggccagtacacagacctgctgcggctgttcgagtacggtgggttcccgccggaggcc
aactacctgttcctcggcgactacgtggaccggggcaagcaatcgctcgagacgatctgt
ctgctgttggcctacaaaatcaaatacccggagaactttttcctgctgcggggcaatcac
gagtgtgccagtattaataggatatacggattctacgacgagtgcaaacgaaggtacaac
gtcaagctgtggaaaaccttcaccgactgtttcaactgcttaccgattgcggccatcatc
gacgagaagatcttctgctgtcacggcggactcagtccggacctgaaccacatggagcaa
atccgacgaatcatgcgaccaacggacgttcccgacactggactgctgtgcgacctgctg
tggagcgatccggacaaggatgttaagggctggggcgagaacgaccgcggcgtcagcttc
acgttcggcgtcgacgtcgtgtccaagttcctggggatgcacgacctggatctgatctgc
cgggcgcaccaggtcgtcgaggacgggtacgagttctttgcgaagcggtcgctcgtgacg
ctcttttccgcgcccaactactgcggcgagtttgacaacgccggcggcatgatgtccgtg
gacgagaacctgatgtgttcgtttcagattctgaaaccgtcggagaagaaggccaaatac
cagtacaccggcacgaacgcccagcggccgcagacgccccagcggaaccagaaccagccg
ctgcccccgaccaaacggaaataa

DBGET integrated database retrieval system