KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002055Help
Entry
CpipJ_CPIJ002055  CDS       T01079                                 

Definition
laminin subunit gamma-1
Orthology
K05635  
laminin, gamma 1
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    CpipJ_CPIJ002055
Cell adhesion molecules and their ligands [BR:cqu04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      CpipJ_CPIJ002055
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      CpipJ_CPIJ002055
     Laminin-2 Extracellular matrix (ECM) components
      CpipJ_CPIJ002055
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      CpipJ_CPIJ002055
   VLA-3
      CpipJ_CPIJ002055
     Laminin-10 Extracellular matrix (ECM) components
      CpipJ_CPIJ002055
     Laminin-11 Extracellular matrix (ECM) components
      CpipJ_CPIJ002055
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      CpipJ_CPIJ002055
     Laminin-8 Extracellular matrix (ECM) components
      CpipJ_CPIJ002055
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      CpipJ_CPIJ002055
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      CpipJ_CPIJ002055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1625 aa AA seqDB search
MCSSYKKWSYFTLSYTVAFITLAICATQASETTHYLPPLECYDPYGRPQRCIPEFENAVY
QVEIEATNTCGEDGDTNFCVQTGYSNRKSCDDCRAGQHSPDYLTDLHDPTNPTWWQSETM
FEGIQYPNQVNLTLKLGKSFDITYIRIVFYSPRPESFAIYKRVSPNGPWIPYQYYSATCR
DTYGLPDSLSVMKGEDESRALCTSEYSDISPLRDGNIAFSSLEGRPSAINFEHSIELQQW
VTATDIRITLDRLNTFGDEVFGDAQVLKSYFYAIADIAVGARCKCNGHASECVTSTNSNG
QRGRVCKCQHYTDGPDCEKCLPFYNDSPWGRATSKNVHECKPCNCNGYSTKCFFDRQLYN
LTGHGGHCIDCGANRDGPNCERCKENFFMREDGYCINCACDPVGSRSLQCNAEGKCQCKP
GVTGDKCDRCENNFYNFGHHGCQPCNCDVRGSLENAPSCDPVNGICSCKENVEGRHCREC
RPGYFNLDLENKFGCTPCFCYGHTSECTSAAGYSIVSTTSNFNKHKEKWSAITATGNPVD
IKYNAKSQTIGVGAQGYDAIYFLAPDRFLGDQRASYNRLLKFRLQLVGQTRPDVSTFDII
LQGANSSISLPIFAQNQPMPDDEFKEFSFRLHEYPEYSWQPSMSARGFMSILSNLTAIKI
RAIYSDYGEAFIDDVELQTAHRGAAGRAATWIEQCTCPEGYLGQFCESCAPGYRHNPALG
GPFMPCIPCDCNKHAEICDSETGRCICQHNTAGDTCDQCAKGYYGNALGGTPYDCKRCPC
PNNGACMQMADESVICLECPVGYFGPRCELCSDGYFGDPTGVHGAIRMCQACDCNGNVDP
NAVGNCNRTTGECLKCIHNTAGLHCDQCLPGHFGDPFALPHGNCEECSCYPRGTEQTDKG
ISICDPNNGNCQCKPNVIGRNCNECKNGYWNIISGNGCENCNCDPTGSYNSSCDTYTGEC
YCKPGIIGKKCDQCALAHYGFSSEGCKSCDCDPSGSKGSQCDQFGQCPCNDNVEGRRCDR
CKENKFDRHQGCLDCPACYNLVQEAANEHRGKLANLNKILQDIQSKPIVIDDNEFVSKLR
TVQDKIDILVEDAKSGSGGGEKTLNEMLQDLEKRLEIVRDLLSKADESQESTEVKNSRGA
NNATIANNQIQDARRELEAAIDLLQTDGAAALSKARDISGHLGNQTNQISGISREARQYA
DQFKKEAEENKKQAEEAHKKASEAHLLAKTTINLQAQIGEEFRTNISNEVQQAKEKLNTV
SKLTDQALTKANEVYDESLSLFVAVNSVSPPSINIDHIKKESNKYNKEADKINADLEKTI
EDHQALLTDVSENIELANTLLERAESQKFDAINAVKELEDAKELAVKAVAEGDGTLKKAN
FTYHTLSGFKNQVDESKQKAADALESVPSIKRQIDNAIELIANSEAALRSANHNALEARN
NAQSAQKKYAEEASKLADSIKKRANTTKNTARDLRHEADQLNGRLAKTENSLAERETNIR
KDFNLTKEAKEKVGQAQLNSNEAKSQVEKAMKEVKAIIDELADLRDIDIKSLNALDDRLT
AAEKELEDAKLTHKLHVLNESKNLQTQNIKSYQREIAELENEVANIKMISDSLPENCYKR
TRLEP
NT seq 4878 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcatcatacaagaaatggtcatatttcaccttgagttatacggtagcattcata
actttggcaatatgtgcaacgcaagcaagtgaaacaacccactatttgccaccacttgaa
tgttacgatccgtacggaagaccgcaacgttgtataccagagtttgagaatgccgtgtac
caagtagagattgaagcaaccaacacatgcggtgaagatggagacactaatttttgtgtt
caaacaggctattccaacagaaaaagttgtgatgattgtcgggctggacaacattctccg
gattatttaactgacttacatgatcctaccaatccaacatggtggcaatccgaaaccatg
ttcgaaggaatccaatatccaaatcaagtgaacttaaccttaaagctaggcaagtcattc
gacataacttacattcgaattgtgttttactcaccacgtccggaatcatttgcaatttat
aaaagagtttcaccaaatgggccatggattccgtatcaatactacagtgcaacctgtcga
gatacttatggattaccagattctctgtctgtcatgaaaggcgaagacgaatctcgtgcg
ctttgcactagcgaatacagtgatatttcgccacttcgggatggcaatatcgcattttct
tcacttgaaggtcgacccagtgccatcaattttgaacacagtattgaattacagcaatgg
gtaactgctacagatattcgcataacattggatcgtctcaacacttttggtgacgaagtt
ttcggcgatgcacaggtgttgaaatcatatttttatgcgatagcagatattgctgttggt
gcgaggtgtaaatgtaatggtcatgccagtgaatgtgtaacaagtaccaattcaaatgga
caacgaggacgcgtatgtaaatgtcaacactataccgatggaccggattgcgaaaaatgt
cttccattctacaatgattcaccttggggacgagcaacatcgaaaaatgttcacgagtgc
aagccctgtaactgtaatggatactcaaccaaatgtttctttgatcggcaactatacaat
ctgactggtcacggtggtcattgtattgattgtggtgccaatcgcgatggaccaaactgc
gaaagatgtaaggaaaatttcttcatgcgtgaagatggctactgtatcaactgtgcttgt
gatccggtcggttctcggtcattacaatgtaatgctgaaggaaaatgccaatgcaagcca
ggcgttactggagacaagtgtgatcgctgtgaaaataatttctataattttggtcaccac
gggtgccagccgtgcaattgtgatgttcggggttcactagaaaacgcgccatcctgtgat
cctgtaaacggtatttgctcatgtaaagaaaatgttgaaggtcgtcattgtcgcgagtgt
agaccaggttactttaacttggatttggagaataaatttggttgtaccccatgcttttgt
tacggccataccagtgaatgcacaagtgccgcaggatactcaatcgtgtcaacaacatca
aatttcaacaagcataaagaaaaatggtctgccattacagccactggaaatcctgtcgat
ataaagtacaatgccaaaagtcaaacaattggagttggagctcaaggatatgacgcaatt
tactttcttgcacctgatcgtttccttggcgatcaacgcgcttcgtataacagattgctc
aagttccgtttgcaactcgtaggccagactagaccagatgtcagcacttttgatataatt
ttgcaaggagccaacagcagtatttcactgccaattttcgctcaaaatcaaccaatgccc
gatgatgaattcaaagagttttcgtttaggctccacgaataccccgaatattcttggcaa
ccatctatgtcagccagaggcttcatgtccattttaagtaacctaacggcaatcaaaata
cgagcaatctattcggattacggtgaagcattcattgacgacgtagaacttcaaacagcg
catcgaggtgctgcaggtcgtgcggcgacctggatcgaacaatgtacatgccctgaagga
tatcttggccaattttgcgagtcgtgtgcacctggttatagacataatccagcgttaggg
gggccgtttatgccatgtattccctgtgattgtaacaagcatgccgaaatttgtgattct
gaaacaggaagatgtatttgccaacataacacagccggtgatacatgcgatcaatgtgct
aaaggatattacggaaatgcgttaggaggaacaccctacgattgtaaacgatgtccttgt
cctaacaatggtgcatgtatgcagatggctgacgagtcggttatttgcctcgaatgtccc
gtcggctattttggaccacgttgtgagttatgctcagatggatattttggagacccaacg
ggagtacacggagccattcgtatgtgccaagcttgtgattgcaatggaaacgttgacccg
aatgctgtgggtaattgtaaccgaacaactggagaatgtttaaagtgtattcacaatact
gcgggtctacactgtgaccaatgcttgcccggtcattttggagatccatttgcactgcct
catggaaactgtgaagaatgtagttgttatccgcgaggaactgagcaaactgataaaggc
atttcaatctgcgaccccaacaatggtaactgtcagtgtaaaccaaatgtgattggacga
aattgcaacgaatgtaaaaatggttactggaatattatctctggaaatggatgtgaaaat
tgcaattgtgatccaactggaagctacaactcatcatgtgatacatatacaggagaatgt
tattgtaaaccaggcattattggcaaaaagtgtgatcagtgtgctttggcacactatgga
ttttcatcagaaggatgtaaatcttgtgactgcgatccgagtggttctaaaggttcacaa
tgcgatcaattcggacaatgtccatgcaacgataacgtcgaaggaagacgttgtgaccgt
tgtaaagaaaacaagtttgatcgtcatcaaggctgtctggattgtcctgcttgttataat
ctcgttcaggaagcagcaaatgaacatcgaggaaaattggcaaacttgaacaaaatattg
caagatattcagtctaaaccgatcgttatcgacgacaatgaatttgtctcgaaattacga
acagtacaagacaaaattgatatcttggttgaagacgccaaaagtggatccggtggagga
gaaaaaacattgaatgaaatgttacaggatttagaaaaaagactagaaattgtgcgtgac
ttactcagcaaagctgatgagtctcaagagtccacggaagtaaaaaatagtagaggagca
aacaacgcaacaattgctaacaatcaaatacaggatgctcgccgcgaattagaagcagcc
attgatttgttacagactgacggagcagctgcgttgagtaaagcacgagacatttctggg
catttaggaaatcaaacaaatcaaattagcggcatatctagggaagcacgacaatatgct
gaccaattcaaaaaagaagccgaagagaacaaaaaacaagctgaagaagcacacaaaaaa
gcgagtgaagctcatttattggccaaaactacaattaacttgcaggcacaaattggagaa
gaattcagaacaaatatttcaaatgaagttcaacaagccaaagaaaaattaaacacggta
tcgaaactgaccgaccaagctttaacaaaggcaaatgaagtatatgacgagtcattatct
ttatttgttgctgttaatagcgtttccccgccaagcatcaatatcgatcacattaaaaag
gaatcgaacaagtataacaaagaagcagacaaaataaatgcagatttggaaaaaacaatt
gaagatcatcaagctttgctcacggatgtaagtgaaaacatcgaacttgccaacacactt
ttagaaagggccgagtctcaaaagtttgacgccataaatgctgttaaggagttggaagat
gctaaagaactggcagttaaagcagttgccgaaggcgatggaacattgaaaaaagctaat
ttcacttaccatactctgtctgggttcaaaaatcaagtagacgaatctaaacaaaaagca
gcagatgcgttagaatcggtacctagcataaaacggcaaatcgataatgccattgagctt
attgctaattctgaagcggctttgagaagcgcaaaccataatgcgcttgaagcacgtaat
aatgctcagtcagcacaaaagaagtatgctgaggaagcttctaagcttgcggatagtata
aaaaaaagagcaaatactaccaaaaatacagctcgcgatttaaggcatgaagctgatcag
ttgaatggtcgattagccaaaacggaaaacagtcttgcagaacgagagacaaatattcga
aaagattttaacttaacgaaagaagctaaggaaaaagttggccaagctcaattgaattca
aacgaggccaaatctcaagtagaaaaggctatgaaagaagtaaaagctattatagatgaa
ctagctgatttgagagacatcgacatcaaaagtttgaatgctttagatgatcgtctgaca
gccgcagaaaaagaattagaagatgccaaactaactcataagttacacgtgttaaatgaa
tccaaaaatctacaaactcaaaatattaaaagctatcaacgggagatagcagaattggaa
aatgaggtagcaaacataaaaatgatttctgattctttaccagaaaattgctataaaaga
acacgtcttgagccataa

DBGET integrated database retrieval system