KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002066Help
Entry
CpipJ_CPIJ002066  CDS       T01079                                 

Definition
alpha-galactosidase A
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CpipJ_CPIJ002066
  Lipid metabolism
   00561 Glycerolipid metabolism
    CpipJ_CPIJ002066
   00600 Sphingolipid metabolism
    CpipJ_CPIJ002066
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    CpipJ_CPIJ002066
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    CpipJ_CPIJ002066
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     CpipJ_CPIJ002066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 428 aa AA seqDB search
MRVIVVLIACFYFCVVLGLENGLARLPPMGWMTWERFRCITDCKKYPTECISENLIMRTA
DLMVLEGYLDAGYEYVNIDDCWMMRERDSEGKLHADPERFPSGIKYLSDYIHSKGLKFGI
YQDIGTHTCAGYPGMKNYFEIDAKTFAEWEVDFIKIDGCYADEVKMVDDYVYFGELMNQT
GRPILYSCSWPAYQEYNGITPNYETLKKTCNMWRNWGDIEDSHSSVESITQYFSDNQDRI
QPHSGPGHWNDPDTLVLGNYGLSYEQSKSQLAVWTILAAPFLLSNDLARVTPDVKALLLN
KEIIAMNQDSLGIQGLLVKTVNKIEIWKKPILPKVKDEMTHGIAFVSRRADGAPYSVSVK
VIEDLGLGGSQYIKGYMVYDLFDAEHKPFFVKVNGTFNTRINPTGANLYRFEPVLNIILR
GKTDINMY
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtgatagtagtactgattgcctgtttttatttttgtgttgttctcggtcttgaa
aatggattggcacggttaccacctatgggctggatgacttgggaaagatttcgttgcata
actgactgcaaaaaatatccaacagaatgcatttcagaaaatctgattatgagaactgct
gacctgatggttttggagggatatctagatgcaggttatgaatatgtaaatatcgatgac
tgctggatgatgagggaaagagactcggaaggaaagttgcatgcagatcctgagcgtttc
cccagtgggataaaatatttatccgattatatacactcaaaaggacttaaattcggaata
taccaagacattggtactcacacatgtgctggatatccaggaatgaaaaattactttgaa
atagatgcaaaaacttttgctgagtgggaagtagattttattaaaatcgatggatgttat
gcagacgaagtcaaaatggttgatgattatgtatattttggagagcttatgaaccaaact
ggtcgaccaatcttatactcttgcagttggccggcctatcaggagtataacgggataact
ccaaactacgagacgcttaagaagacctgcaatatgtggagaaattggggtgatatcgaa
gattctcatagctcggttgaatcaattacgcagtacttttctgacaatcaagaccgcatt
caaccacattctgggccaggccactggaatgatccagatacgctcgttcttggcaactat
ggcctcagttatgaacagagtaaatcacaattggcagtatggactattctcgcggcacct
tttcttctatctaatgatctagcaagagttacaccggatgtaaaagctcttcttttgaat
aaagagataattgcgatgaatcaagactccttaggcattcaagggttgttagtaaaaaca
gtcaacaaaatcgagatatggaaaaaacctattctaccgaaggtgaaagatgagatgacc
catggcatagcttttgtaagccgacgagccgacggagcaccgtattccgtcagtgtcaag
gtgattgaagatcttggactaggtggcagccagtatatcaaaggatacatggtttacgat
ctttttgacgcagagcataaaccatttttcgttaaagtaaatggaactttcaacacacgt
attaacccaacgggagcaaacttataccggtttgaacctgtacttaatataattcttcga
ggaaaaacggatataaacatgtactag

DBGET integrated database retrieval system