KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002095Help
Entry
CpipJ_CPIJ002095  CDS       T01079                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CpipJ_CPIJ002095
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CpipJ_CPIJ002095
Exosome [BR:cqu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CpipJ_CPIJ002095
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 531 aa AA seqDB search
MSTAIKIKNFSNTWWIQRNPEGNDTVIMHPPPVSLPTDEKETLRQKRLISASEYEKTAQF
WNVGAQLKLKEQLLKRTNRNVAKNVIFFLGDGMSIPTLAASRMYLGQMHGHTGEETQLSF
EEFPDVGLVKTYCVDKQVADSACSATAYLTGVKANYATIGVTAAVKYNNCADSSDPKNHV
QSIMSWAQAAGKGTGIVTTTRVTHASPAGTYAHVANRDWESDADVEAKVEDSSQCQDIAS
QLVRNEPGKNFNVILGGGRRKFIPKNEKDVSGKPGQRMDSANLISEWFYSKPMGTARYVT
NKRDLMGINFNETEYLMGLFNSDHLKYHMDSDLSEDPSLSDLTYAAIKSLEKHRNGFVLF
IEGGKIDLAHHETKARKSLDETVQFSEAVLLATQLTNSDNTLIVVTADHSHVMSLAGYSK
RGHDILDISDSISDVDKKAYTTLSYANGPGGPGPDEKGHRRNITQQMVKNKEFQYPKMVP
LKYETHGGDDVALFAYGPWSHLFGGMYEQNVIPHLIGYAACIGDGLTACKR
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtccacggccatcaaaatcaagaatttctccaacacctggtggatccagaggaaccca
gaggggaacgacacggtgattatgcacccaccgccagtgagtttaccaacggatgagaag
gagactttgcgccaaaagagattgatttcggcatccgagtacgagaaaaccgcccaattt
tggaacgtcggagcccagttgaagctgaaggaacaactgctgaagcgcaccaatcgtaac
gtggccaagaatgtgatatttttccttggcgatgggatgtcgattcccaccctggcggcc
agtaggatgtacctcgggcagatgcatggtcacaccggtgaagaaacgcaactatccttc
gaagagttcccagacgtcggcctggtgaagacgtactgtgtggataaacaagttgcagat
tctgcatgctcggccacggcataccttactggggtgaaggcaaattatgccaccattggt
gtgacggctgcggttaaatacaacaattgtgccgatagcagtgacccaaagaatcatgtc
cagtcaataatgagctgggcgcaggctgccggtaaaggaaccggaattgtcaccaccaca
agagtcacgcacgcaagcccggccggaacctacgctcacgtggcgaaccgtgattgggaa
agtgacgccgacgtcgaggccaaagtggaagactcttcgcagtgtcaggatattgcttcc
cagttggtgcggaatgaacccgggaagaactttaacgtcattctgggtggaggtaggaga
aagtttataccgaaaaacgaaaaggatgtctcggggaagccaggccagcggatggactct
gcaaacctcatctcggaatggttctacagcaaaccgatgggaacggccagatacgttacc
aacaagcgtgacctcatgggtatcaactttaacgaaaccgaatatctgatgggactcttc
aactcggatcatctcaaataccacatggacagtgacctttcggaggatccttcgcttagt
gacctgacctacgcagcaatcaaaagcctcgagaagcaccgaaacgggtttgttctgttc
atcgagggtggcaaaatcgatctggcccatcacgaaaccaaagcccgcaaatctctcgac
gaaacggtacaattctcggaggcagttttactcgccactcagctaaccaattcggacaac
acactgattgtcgtaacagcggatcattcccacgtaatgtccctcgccggttattcaaag
cgtggacacgatattctcgatattagtgactcaattagtgacgtcgataagaaagcgtac
accactctttcgtacgccaacggacccggaggaccgggcccggatgagaaaggccatcgg
cggaacattacgcagcagatggtcaagaacaaagagttccagtatccgaagatggtgccg
ctcaagtatgaaacccacggtggcgacgatgtcgcgctctttgcgtatggtccttggtct
cacttgtttggtggcatgtacgagcaaaacgttatcccacacttgattggatatgcagct
tgcattggagatggtttaaccgcgtgtaaacgatag

DBGET integrated database retrieval system