KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002102Help
Entry
CpipJ_CPIJ002102  CDS       T01079                                 

Definition
(RefSeq) apoptosis 1 inhibitor
  KO
K16061  baculoviral IAP repeat-containing protein 7/8
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04120  Ubiquitin mediated proteolysis
cqu04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    CpipJ_CPIJ002102
 Cellular Processes
  Cell growth and death
   04215 Apoptosis - multiple species
    CpipJ_CPIJ002102
Ubiquitin system [BR:cqu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    CpipJ_CPIJ002102
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-RING_2 zf-RING_5 zf-RING_UBOX
Motif
Other DBs
NCBI-GeneID: 6032833
NCBI-ProteinID: XP_001843370
VectorBase: CPIJ002102
UniProt: B0W3T6
AA seq 409 aa AA seqDB search
MTAQVLSIPRDYTDNKVKDENTSYGLTGTSVTYHIEVSRLESFLNWSIPFISKFELARFG
FYYVGPGDMVKCFFCRVEIGLWEPNDNVLSEHLRWSPYCPLLRKRPTNNQPLDASFLDQL
PEPSYDTCGIQIRQHSVAENAYSSSDRSSSGSMSSPPSSLTSESSMMSNTSGGVGATELQ
PPQQQHKLPEYPNYAIEAKRLESYEDWPKFMKQKPKELSDAGFFYTGKSDRVKCFSCGGG
LKDWEAGDEPWEQHAMWYSNCEYLKLMKGEEYIAQCLAKKENSSEMSEQPQDVGPSSSPQ
PSTSGVASAATTSLPSSQSSSLSTSVEESNPMTSMAAPMSGSSGLEEDEDEPNRKQDTSR
TCKICYVNEYNTAFSPCGHVVACAKCASSVTKCPLCRKPFTNVMRIYLM
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgcaagttctatcaataccacgggattatactgataacaaagtgaaggatgaa
aacacatcgtacggattaacggggacatcagtgacataccatatagaagtgtctcggctg
gaatcgtttttaaactggagcataccgttcatcagcaagttcgagttggctcggtttgga
ttttattatgtggggccgggtgacatggtgaagtgcttcttctgtcgggttgaaattgga
ctgtgggagccgaatgataatgtgttatcggaacacttgcggtggtctccgtactgtccg
ttgctgcgcaagcgcccaacaaataatcaaccgctcgatgcaagtttcctggaccaactg
ccggagcccagctatgatacctgtggtatccagattaggcagcactccgtggcagagaat
gcgtactcgtcgtcggacagaagcagcagcggatcgatgtcctcgccaccgagctcgttg
acgtccgagtcaagtatgatgtccaatacgtccggaggtgtcggagcaactgaactacag
ccaccccagcagcagcacaaacttcccgaatatcccaactatgctatcgaagcgaagcgg
ctagaaagctacgaagactggccaaagtttatgaagcaaaagccgaaggaactcagcgat
gctggattcttctacacgggcaagagcgatcgagtcaagtgcttcagctgtgggggaggt
ctgaaggactgggaggccggggatgagccctgggagcaacatgctatgtggtatagcaac
tgtgagtacctgaaacttatgaagggcgaagagtacatcgcccagtgcttggccaagaag
gaaaattcttcggaaatgtccgagcagccgcaggacgtcggcccatccagctccccgcag
ccgtcaacgtccggagtcgcgtcggcggccaccacctcgctaccttcatcacagtcatcc
agtctgagcacttcggtcgaagaaagcaatcctatgacatcgatggcggcacccatgtcc
ggcagcagtggcctcgaggaagacgaggacgaaccgaaccgcaagcaggacacgagccga
acgtgcaaaatttgctacgtcaacgagtacaacaccgcgttctcaccgtgtggccacgtt
gtggcgtgtgccaagtgcgcctcgtcggtcaccaagtgtcccctgtgccggaagcccttt
accaatgtgatgcgaatttacctgatgtga

DBGET integrated database retrieval system