KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002102Help
Entry
CpipJ_CPIJ002102  CDS       T01079                                 

Definition
(RefSeq) apoptosis 1 inhibitor
  KO
K04725  
E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    CpipJ_CPIJ002102
Enzymes [BR:cqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     CpipJ_CPIJ002102
Ubiquitin system [BR:cqu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    CpipJ_CPIJ002102
Mitochondrial biogenesis [BR:cqu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    CpipJ_CPIJ002102
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 409 aa AA seqDB search
MTAQVLSIPRDYTDNKVKDENTSYGLTGTSVTYHIEVSRLESFLNWSIPFISKFELARFG
FYYVGPGDMVKCFFCRVEIGLWEPNDNVLSEHLRWSPYCPLLRKRPTNNQPLDASFLDQL
PEPSYDTCGIQIRQHSVAENAYSSSDRSSSGSMSSPPSSLTSESSMMSNTSGGVGATELQ
PPQQQHKLPEYPNYAIEAKRLESYEDWPKFMKQKPKELSDAGFFYTGKSDRVKCFSCGGG
LKDWEAGDEPWEQHAMWYSNCEYLKLMKGEEYIAQCLAKKENSSEMSEQPQDVGPSSSPQ
PSTSGVASAATTSLPSSQSSSLSTSVEESNPMTSMAAPMSGSSGLEEDEDEPNRKQDTSR
TCKICYVNEYNTAFSPCGHVVACAKCASSVTKCPLCRKPFTNVMRIYLM
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgcaagttctatcaataccacgggattatactgataacaaagtgaaggatgaa
aacacatcgtacggattaacggggacatcagtgacataccatatagaagtgtctcggctg
gaatcgtttttaaactggagcataccgttcatcagcaagttcgagttggctcggtttgga
ttttattatgtggggccgggtgacatggtgaagtgcttcttctgtcgggttgaaattgga
ctgtgggagccgaatgataatgtgttatcggaacacttgcggtggtctccgtactgtccg
ttgctgcgcaagcgcccaacaaataatcaaccgctcgatgcaagtttcctggaccaactg
ccggagcccagctatgatacctgtggtatccagattaggcagcactccgtggcagagaat
gcgtactcgtcgtcggacagaagcagcagcggatcgatgtcctcgccaccgagctcgttg
acgtccgagtcaagtatgatgtccaatacgtccggaggtgtcggagcaactgaactacag
ccaccccagcagcagcacaaacttcccgaatatcccaactatgctatcgaagcgaagcgg
ctagaaagctacgaagactggccaaagtttatgaagcaaaagccgaaggaactcagcgat
gctggattcttctacacgggcaagagcgatcgagtcaagtgcttcagctgtgggggaggt
ctgaaggactgggaggccggggatgagccctgggagcaacatgctatgtggtatagcaac
tgtgagtacctgaaacttatgaagggcgaagagtacatcgcccagtgcttggccaagaag
gaaaattcttcggaaatgtccgagcagccgcaggacgtcggcccatccagctccccgcag
ccgtcaacgtccggagtcgcgtcggcggccaccacctcgctaccttcatcacagtcatcc
agtctgagcacttcggtcgaagaaagcaatcctatgacatcgatggcggcacccatgtcc
ggcagcagtggcctcgaggaagacgaggacgaaccgaaccgcaagcaggacacgagccga
acgtgcaaaatttgctacgtcaacgagtacaacaccgcgttctcaccgtgtggccacgtt
gtggcgtgtgccaagtgcgcctcgtcggtcaccaagtgtcccctgtgccggaagcccttt
accaatgtgatgcgaatttacctgatgtga

DBGET integrated database retrieval system