KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002146Help
Entry
CpipJ_CPIJ002146  CDS       T01079                                 

Definition
circadian locomoter output cycles kaput protein
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Circadian rhythm - fly
Class
Organismal Systems; Environmental adaptation; Circadian rhythm - fly [PATH:cqu04711]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 344 aa AA seqDB search
MAEIIVHRTVWRSEILIAEVAKQATRVRGGCGRAGRKEKRVVELWTGGTAIAVGVGKSRN
LSEKKRRDQFNLLVNELSSMVSSNSRKMDKSTVLKSTIAFLKSHNEIAVRSRVHEIQTDW
KPSFLSNEEFTHLILEALDGFIIVFSSTGRVFYASESITSLLGHLPSDLSNMTVYDMVYE
DDQNDLYNILLNPAAVVDPLQTGISRENQVTFACYIKRGTADYRSEVSYELVQFTGYFRS
DVDADSLMTTSRFSTYMNDADTRLIFVGTGRLQTPQLIREMSIVDSSKSEFTSRHSLEWK
FLFLDHRAPPIIGYLPFEVLGTSGYDYYHFDDLEKVVSCHEACK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaattattgtacatcgtacagtttggcggtccgagatcctgattgctgaggtg
gcaaagcaggctacgcgtgtgcgagggggttgtgggagggcaggacgaaaggaaaaacgg
gtggtcgaactgtggacaggtggaacagccatcgcagttggcgttggaaaatctcgcaat
ctcagcgagaagaaacggcgcgaccagttcaacctgctcgtcaacgagctcagctcgatg
gtgtcctccaacagccgcaagatggacaagagcaccgtgctcaagtcgacgattgcattt
ctcaagagtcacaacgagattgcggtgcggtctcgcgtgcacgagatccaaaccgactgg
aagccgtcgttcctgtcgaacgaggagtttacccacctgatcctggaggcgctggacggg
ttcatcatcgtgttctcctcgacgggacgggtattttacgcgtcggagagcatcacctcg
ctgctggggcacttgccgagcgacctgtccaacatgacggtctacgacatggtttacgag
gatgatcagaacgatctgtacaacattctgttgaatccggccgccgtcgttgatccactg
cagactggcatttcccgcgagaaccaggtcacgttcgcgtgttacataaagcgtggcacg
gccgactaccggtcggaggtttcctatgagttagtacaatttaccgggtattttagaagt
gacgtggatgcggactcgttgatgaccacgtccaggttcagcacctacatgaacgacgcc
gacacgaggctaatcttcgttggtacgggacgattacagacgccccagctgattcgggaa
atgtccattgtggacagctccaagagcgagttcacctccaggcatagcttggagtggaaa
tttctcttcctggaccaccgagcaccaccgatcattgggtatttgccgttcgaagtgttg
ggaacttccgggtacgattactaccactttgatgatttggagaaggtggtgtcctgtcac
gaagcttgtaagtag

DBGET integrated database retrieval system