KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002146Help
Entry
CpipJ_CPIJ002146  CDS       T01079                                 

Definition
circadian locomoter output cycles kaput protein
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Circadian rhythm - fly
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Organismal Systems
  Environmental adaptation
   04711 Circadian rhythm - fly
    CpipJ_CPIJ002146
Enzymes [BR:cqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CpipJ_CPIJ002146
Transcription factors [BR:cqu03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    CpipJ_CPIJ002146
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 344 aa AA seqDB search
MAEIIVHRTVWRSEILIAEVAKQATRVRGGCGRAGRKEKRVVELWTGGTAIAVGVGKSRN
LSEKKRRDQFNLLVNELSSMVSSNSRKMDKSTVLKSTIAFLKSHNEIAVRSRVHEIQTDW
KPSFLSNEEFTHLILEALDGFIIVFSSTGRVFYASESITSLLGHLPSDLSNMTVYDMVYE
DDQNDLYNILLNPAAVVDPLQTGISRENQVTFACYIKRGTADYRSEVSYELVQFTGYFRS
DVDADSLMTTSRFSTYMNDADTRLIFVGTGRLQTPQLIREMSIVDSSKSEFTSRHSLEWK
FLFLDHRAPPIIGYLPFEVLGTSGYDYYHFDDLEKVVSCHEACK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaattattgtacatcgtacagtttggcggtccgagatcctgattgctgaggtg
gcaaagcaggctacgcgtgtgcgagggggttgtgggagggcaggacgaaaggaaaaacgg
gtggtcgaactgtggacaggtggaacagccatcgcagttggcgttggaaaatctcgcaat
ctcagcgagaagaaacggcgcgaccagttcaacctgctcgtcaacgagctcagctcgatg
gtgtcctccaacagccgcaagatggacaagagcaccgtgctcaagtcgacgattgcattt
ctcaagagtcacaacgagattgcggtgcggtctcgcgtgcacgagatccaaaccgactgg
aagccgtcgttcctgtcgaacgaggagtttacccacctgatcctggaggcgctggacggg
ttcatcatcgtgttctcctcgacgggacgggtattttacgcgtcggagagcatcacctcg
ctgctggggcacttgccgagcgacctgtccaacatgacggtctacgacatggtttacgag
gatgatcagaacgatctgtacaacattctgttgaatccggccgccgtcgttgatccactg
cagactggcatttcccgcgagaaccaggtcacgttcgcgtgttacataaagcgtggcacg
gccgactaccggtcggaggtttcctatgagttagtacaatttaccgggtattttagaagt
gacgtggatgcggactcgttgatgaccacgtccaggttcagcacctacatgaacgacgcc
gacacgaggctaatcttcgttggtacgggacgattacagacgccccagctgattcgggaa
atgtccattgtggacagctccaagagcgagttcacctccaggcatagcttggagtggaaa
tttctcttcctggaccaccgagcaccaccgatcattgggtatttgccgttcgaagtgttg
ggaacttccgggtacgattactaccactttgatgatttggagaaggtggtgtcctgtcac
gaagcttgtaagtag

DBGET integrated database retrieval system