KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002174Help
Entry
CpipJ_CPIJ002174  CDS       T01079                                 

Definition
mitogen-activated protein kinase 14B
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    CpipJ_CPIJ002174
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CpipJ_CPIJ002174
Protein kinases [BR:cqu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   CpipJ_CPIJ002174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 207 aa AA seqDB search
MVAPGRALVTNSATDSQHNAKVAIKKLARPFQSAVHAKRTYRELRMLKHMNHENIIGLLD
VFHPGGNTLDSFQQVYMVTHLMGADLNNIIRTQRLSDDHVQFLVYQILRGLKYIHSAGII
HRDLKPSNIAVNEDCELKILDFGLARPTENEMTGYVATRWYRAPEIMLNWMHYNQTVDIW
SVGCIMAELLTSRTLFPGTDPDLSITE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggtggcacctggccgcgcgttggtcaccaattcggctaccgatagccagcacaacgcc
aaggtggccatcaagaagctggcgcgcccattccagtcggcggtacacgctaagcgaacg
taccgcgaacttcgcatgctgaagcacatgaaccacgagaacatcatcgggctgctggac
gtgtttcatcccggtgggaacacgctggactcgttccagcaggtctacatggtgacgcat
ctgatgggggccgacctgaacaacatcatccgaacgcagcgcctctccgacgaccatgtg
cagtttctagtctaccagatattgcgtggccttaagtacattcacagcgccggtattata
cacagggatttaaagccgtccaacattgccgtcaacgaagattgcgagcttaaaattctc
gactttggtctggcccgaccgacggagaacgaaatgaccggttacgtggcgacccggtgg
taccgggcgccggagatcatgctcaactggatgcactacaaccaaacggtggacatctgg
tccgtcgggtgcatcatggccgaactgctgaccagccggacgctcttccccggcacggac
cctgatctgtcaataacggagtag

DBGET integrated database retrieval system