KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002177Help
Entry
CpipJ_CPIJ002177  CDS       T01079                                 

Definition
eukaryotic translation initiation factor 3 subunit 9
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:cqu03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 688 aa AA seqDB search
MAKKKGDQYDSDGAEDQDYDEEPVFEDPAGFVDDVGDDELLGDFLKQKPCESDGVENVIV
VDNIPVVGPARFPKLQGVLEKIFKNAGTIVNIHYPKDDEENTKGFAFIEFKNPEMAEEAV
KAFNNYRLDKSHTLLVNLFSDFQKYSDIPKDWSPPESQPYKVQNDLYTFLSEPDAQDQFC
VVAESTPGAVQVQFWHNTQPEPVELLTRERFTETYVKWSPLGTYIVTFHKQGVVIWGGSS
FTKINKFAHSNTQYVDFSPCEQYLVTYGPNGQKIIIWDIRTGTEKRSFVSDGSSNMSMFR
WSHDDKYVARMGDNAIHVYETNTFYLLDKKSIKVQGIRNFSWSPTDNIIAYWMSEDIDAP
ARVTLLEIPKKIEVRNKNLFNVADCKIHWQKSGDYLCVKVDRYSKSKKDKKDADVKFLGM
FYNFEIFHMREKDIPVDSVEVKETILAFAWEPVGSKFSIIHGEPSNANVSFYEAKKGQEP
TMLRKMEKKVCSHLFWSPRGQFIVLANLQMGSFEFVDTNDFTIMKSGDHYRASEVEWDPT
GRYVVTGTSGKVKEDHGYHLWSFQGRILKRVNLKNFMLFLWRPRPPTLLPDERQKEIRKN
LKKYYAQFESKDRVRMTRASKELLEKRAKLREQFVEYRAKRVNDWEEQKYRRMQLRNNMD
TDTLEADPDNVEEEIVEILVREDTTLLE
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaaagaaaggcgaccagtacgacagcgatggggccgaggaccaggactacgac
gaggagcccgtctttgaggatccggccggtttcgtggacgacgtcggcgatgacgaactg
ctgggagattttttgaagcagaagccgtgcgagtcggatggggtggagaatgtgattgtg
gtggacaacattccggtggttgggccggctcggttcccgaagttgcagggagtgttggag
aagatctttaagaatgccgggacgattgtgaatattcactacccgaaggacgatgaggag
aacacgaagggattcgcgtttattgagtttaagaatccggagatggctgaggaagcggtg
aaggcgttcaacaactaccggttggacaagtcgcatacgttgctggtgaatctgttttcg
gacttccaaaagtactcggacattccgaaggattggagcccaccagagtcgcagccgtac
aaggtgcaaaatgatttgtacacgttcttgtcggagccggacgcgcaggaccagttctgt
gtggtcgctgagtcgacgcctggcgccgtgcaggttcagttttggcacaacacgcaaccc
gaaccggttgagctgttgacgcgtgagcgattcacggaaacctacgtcaagtggtcgccg
cttgggacgtacattgtgacgttccacaagcagggagtcgtcatctggggcggttccagc
ttcaccaagatcaacaagtttgcccactccaacacccagtacgtggacttttccccctgc
gaacagtatttggtaacgtatggcccgaacggccagaagatcatcatctgggacatccgc
accggtacggagaagcgatcgttcgtgtcggacggctcctccaacatgtccatgttccgc
tggtcccacgacgataagtacgtcgcacggatgggcgacaacgcgatccacgtctacgaa
accaacacgttctacctgctcgacaagaagtccatcaaggtgcagggcatccgcaacttc
agctggtcccccacggacaacattatcgcgtactggatgtccgaggacattgacgccccg
gcccgtgtgaccctgctcgagatccccaagaagatcgaagtccgcaacaagaacctgttc
aacgtcgccgactgcaagatccactggcaaaagtccggcgattacctgtgcgtcaaggtc
gaccgctactccaagtccaagaaggacaaaaaggacgccgacgtcaagttcctcggcatg
ttctacaactttgaaatcttccacatgcgcgaaaaggacatccccgtggactcggtcgag
gtgaaggaaacgatcctcgcgttcgcctgggaaccggtcggctccaagttctccatcatc
cacggcgaaccgtcgaacgcgaacgtcagcttctacgaggccaagaagggccaggagccg
acgatgctccgcaagatggagaagaaggtgtgcagccatctgttctggtcgccgcgcggc
cagttcatcgtgctggccaacctgcagatgggctcgttcgagtttgtcgacacgaacgac
tttacgatcatgaagagcggcgaccactaccgtgcgtccgaggtcgagtgggacccgacc
gggcggtacgtcgtgaccggaacgtctggaaaggtcaaggaggaccacggctaccacctg
tggtcgttccagggccggatactgaagcgtgtcaacctgaagaacttcatgctgttcctg
tggcggccgcgcccgccaacgctgctgcccgacgagcgccagaaggagattcgcaagaac
ctcaagaagtactacgcgcagttcgagagcaaggaccgcgtccggatgacgcgcgcctcg
aaggagctgctcgagaagcgggccaagctgcgcgagcagtttgtcgagtaccgcgccaag
cgggtcaacgactgggaggagcaaaagtatcgccgcatgcagctgcgaaacaatatggat
accgatacgctggaggctgatccagacaatgtggaggaggagattgttgaaattctagta
cgcgaagacaccaccctgctcgagtag

DBGET integrated database retrieval system