KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002184Help
Entry
CpipJ_CPIJ002184  CDS       T01079                                 

Definition
(RefSeq) hypothetical protein
  KO
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CpipJ_CPIJ002184
Peptidases [BR:cqu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CpipJ_CPIJ002184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 380 aa AA seqDB search
MGANISQLERDIGADQFPPNEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNK
RTKETLLSCLADLFYSIATQKKKVGSIAPKKFIARLRKEKEEFDNYMQQDAHEFLNFLIN
HINEIILAERNQAKGGTAAGGTTTSKNGHVGTATPSLNHLLNGCGTGENGTQQPQEPTWV
HEIFQGILTSETRCLNCETVSSKDENFFDLQVDVDQNTSITHCLRCFSNTETLCSDNKFK
CDNCCSYQEAQKRMRVKKLPMILALHLKRFKYMEQYNRHIKVSHRVVFPLELRLFNTSDD
AVNPDRLYDLMAVVIHCGSGPNRGHYISIVKSHGFWLLFDDDMVDKIEASTIEDFYGLTS
DIQKSSETGYILFYQSRDAT
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgggagccaacatttctcagcttgagcgtgatatcggtgccgatcagttccctcccaat
gagcactactttggattagttaattttggtaacacctgctacagcaactcggtcctgcag
gcgttgtacttttgccgaccgttccgagagaaggttctcgagtacaaggccaagaacaaa
cgtaccaaggagacgctgctgtcctgcctggccgatctattctacagcattgcgacgcag
aagaaaaaggtcggttcaatcgcgccaaagaagtttatcgcccggttgcggaaggagaag
gaggagttcgacaattacatgcagcaggatgcgcacgagtttctcaactttctcatcaac
cacatcaacgagatcatcctggccgagcggaaccaggccaagggcggcacagccgccggc
ggtacgaccacgagcaaaaatggccacgtaggtacagccaccccgtccctgaaccatctg
ctgaacggctgcggtaccggagagaacggcacccagcaaccccaggaaccgacctgggtg
cacgaaatattccagggcatcctgacgagtgaaacgcgctgcctaaactgcgaaaccgtc
agcagcaaggacgaaaacttcttcgacctgcaggtggacgtcgatcagaacaccagcata
acgcactgtctgcggtgcttcagcaacaccgagacgctgtgcagtgataacaagttcaag
tgcgacaactgctgcagctaccaggaggcgcagaagcggatgcgcgtcaaaaagctaccg
atgatcctggcgctgcacctgaagcggttcaagtacatggagcagtacaaccggcacatc
aaggtgtcccaccgggtcgtgtttccgctcgagctgaggctgttcaacacgtcggacgac
gccgtcaacccggaccgcctgtacgacctgatggccgtggtgatccactgcgggtccggc
ccgaaccggggccactacattagcattgtgaagagtcacggattttggctgttgtttgat
gacgatatggttgataaaatcgaagcatccactatcgaggacttttacgggctcacgtcg
gacatccagaagtcgtccgaaacgggctacatcctcttctaccagtcacgggacgcgacc
tga

DBGET integrated database retrieval system