KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002331Help
Entry
CpipJ_CPIJ002331  CDS       T01079                                 

Definition
DNA repair and recombination protein RAD54
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cqu03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 821 aa AA seqDB search
MRRSCAPSMKRSLPAEPTIRPQPLPQAQPDPGMLELLTSSENHARVLEARAATATAVRKP
ATLDTRAEPTTSQVRFKVCWGKITTKKHKTWEGDGTLTVVGGKSATLRDEDGKVIGSAGS
VKGEELEEGSRLIVGSKEVELVERIDGEGRVLEMAKENDGPVKRVRVEARGGFKPPAESM
CAGRPIVVSSFKQVGTVGEEAIAEDFVPLTMREPSFDHQWKYNKGKVPVVTREGVSFLYE
CVLGMKREDSEQFGAILADEMGLGKTLQTLALIYTLMKQGPYGQPIVKRVLIVTPSSLVD
NWDREITKWLKQERIYTFIVGPNNKLKKYAQSAHIPILIISYELLAKQVSELETVKFDLI
VCDEGHRLKNSSIKIAEVLDGIDCRRRILLTGTPIQNDLQEFHSLINFVNPGLLGTYSEF
KAKYENPIVQSQQPNVLPQLQELGQTRLNELNSITSSFILRRTQEVNNSYLPEKQELVIF
AHPSELQERLLTLALKHYEQSGTSAITPLQLITILKKICNHPSLISTTDSKDPDSLQNLL
ISQLPSWQHMGPADSGKLAILESLLEALIERREKVVIVSYFSKTLDMIAGLCEHYNYKFC
RLDGATPSQDRGKLVATFNNPSSDIFIFLLSAKAGGIGLNLVGASRLVLFDNDWNPASDL
QAMSRIWRDGQTRNVFIYRLITAFSIEEKIFQRQISKTSLSGSVVDQKQNLSNLKLSDDE
LKDLFSLVEEDDREDCLTHQMLSCECAGSGDVPEPAGAASSQEEVESPERSRYRVKLAKT
KKKQKHSLKMQELLKWQHHRAPVQQEVLEVDSLIVKETLSN
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcagttgcgccccctcgatgaaacggtccttgccggccgaaccgacaatccga
ccgcagccgttaccgcaagcccaaccggacccgggcatgctggagctgctcaccagctcg
gagaaccatgcccgcgtgttggaagcccgagccgccaccgccaccgcagtcagaaagccg
gcgacgttggacacccgcgcagaaccaacgacgtcgcaagtgcgcttcaaagtgtgctgg
ggcaaaataacgaccaaaaagcacaaaacgtgggagggcgacggaacgttaaccgtcgtg
ggcgggaagagcgccacgttgcgcgacgaggacggcaaggtgattgggagcgccgggtcg
gtgaagggggaggagttggaggagggttcgcggttgattgtggggagcaaggaggttgag
ctggtggagcggattgatggggagggaagggttttggagatggccaaggagaatgatggg
ccggtgaagagggttcgagtggaggcgagaggagggtttaagccgccggcggagtcgatg
tgcgccgggaggccgattgtggtgtcgagctttaagcaggttgggacggtgggggaggaa
gcgattgccgaggactttgttccgttgacgatgcgggaaccatcgttcgatcatcagtgg
aagtataataagggtaaggttccggttgtgacgcgggaaggggtgagctttctgtacgag
tgcgttttgggcatgaaacgtgaagattcggaacagtttggagcgattttggccgacgag
atgggactggggaagacactgcagacgttggcgttgatctacacgctgatgaagcaggga
ccttacgggcagccgattgtgaagcgggttctgatcgtgactccgagcagtttggtggac
aactgggatcgagagataacgaagtggttgaagcaggaacggatctatacgttcatcgtt
gggccgaataacaagctgaaaaagtacgcgcaatcagcgcacattccaattttgatcatc
tcgtacgagctgttggccaagcaggtaagcgagctggagacggtcaaatttgatctgatt
gtttgtgacgaagggcatcggctcaagaatagcagcatcaagatcgcagaagttctggac
gggattgactgtcgacgtagaattctgctcaccggaacgccgatccagaacgacctgcaa
gaatttcattcgttgatcaattttgtcaaccctggattgctcggcacctactcagaattc
aaagccaaatacgagaacccgatcgtacaatcgcaacagccgaatgtccttccacagttg
caagaactgggccaaacccgactcaacgagctaaactccatcacctcctcgttcattttg
cgtcgaacgcaggaagtcaacaacagctacctcccggagaagcaagaactggttattttt
gcccacccttcagaactccaagagaggcttctgacgctggccctgaagcactacgaacaa
agcggaaccagcgccataacaccacttcagctcatcacgatcctcaaaaagatctgcaac
catccgtcgctcatctcaacaactgattccaaagacccggactcgctgcagaacctcctc
atttcccaacttcccagctggcaacacatgggccccgccgactccggcaagctcgccatc
ctggaatccctgctcgaagcccttatcgagcggcgagaaaaagtcgtcatcgtgtcctac
ttcagcaaaaccctggacatgatcgccggcctgtgcgagcactacaactacaagttctgc
cggctagacggcgccacaccctcccaagaccgtggcaaactggtcgccaccttcaacaac
ccgtcctccgacatcttcatcttcctgctgagcgccaaagccggcggaatcggactcaac
ctggtcggcgcctcacggctcgtgctcttcgacaacgactggaacccggcgagtgacctc
caggccatgtcccgcatctggcgcgacggacaaacccggaacgtcttcatctatcgactc
atcaccgccttctccatcgaggagaaaatcttccagcggcaaatctccaagacctcgctc
agcggatccgtcgtcgaccagaagcagaacctcagcaatttgaagctctccgacgacgaa
ctcaaagacctgttttcgctggttgaagaggacgaccgggaggactgcctgacgcaccag
atgttgtcctgcgagtgcgccggaagtggggacgttccggaaccagcgggagccgcctcc
agccaggaagaggtggaatcgcccgagcgaagtcggtatcgggtgaagttggccaaaaca
aagaagaagcaaaagcattcgctcaaaatgcaggagctgctgaagtggcagcaccatcgg
gcaccagtgcagcaggaagtgcttgaggtagattcgttgatcgtgaaggaaactttgtcg
aactaa

DBGET integrated database retrieval system