KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002354Help
Entry
CpipJ_CPIJ002354  CDS       T01079                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:cqu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cqu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cqu00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cqu00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:cqu00562]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 221 aa AA seqDB search
MGRKFCVGGNWKLNGDKASITELCKVLTTGPLNADTENCYKVAKGAFTGEISPAMLKDLN
IGWVILGHSERRAIFGESDELIADKIVHALAEGLKVIACIGETLQEREAGQTEAVCFRQT
KAIADKVKDWSNVVIAYEPVWAIGTGKTATPEQAQEVHAALRKWFTENVSADVSAAIRIQ
YGGSVTAANCRELAAKPDIDGFLVGGASLKPEFIQIVNARA
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtaagttctgcgttggaggcaactggaagttgaacggcgacaaggccagcatc
accgagctgtgcaaggtgctgacgaccggtccgctgaacgccgacaccgagaactgctac
aaggtcgccaagggtgccttcaccggtgagatctcgccggccatgctgaaggatctgaac
attggctgggtcatcctgggccactcggagcgtcgtgccatcttcggcgagtcggacgag
ctgattgccgacaagatcgtgcacgcgctggccgagggcctcaaggtgattgcctgcatc
ggtgagaccctgcaggagcgtgaggctggccaaaccgaggccgtttgcttccgccagacc
aaggccatcgccgacaaggtcaaggactggtccaatgttgtgattgcgtacgaaccagtg
tgggccatcggaaccggcaagaccgccaccccggaacaggcccaggaggtgcacgccgca
ctcaggaagtggttcacggagaacgtgtccgccgatgtgtccgcggcgatccgcatccag
tacggaggttccgtgaccgctgccaactgtcgcgagctggccgccaagcccgacattgac
ggattcctggtcggtggagcctcgctcaagccggagttcattcagattgtcaacgccaga
gcgtaa

DBGET integrated database retrieval system