KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002354Help
Entry
CpipJ_CPIJ002354  CDS       T01079                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00010  Glycolysis / Gluconeogenesis
cqu00051  Fructose and mannose metabolism
cqu00562  Inositol phosphate metabolism
cqu01100  Metabolic pathways
cqu01200  Carbon metabolism
cqu01230  Biosynthesis of amino acids
Module
cqu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cqu_M00002  Glycolysis, core module involving three-carbon compounds
cqu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpipJ_CPIJ002354
   00051 Fructose and mannose metabolism
    CpipJ_CPIJ002354
   00562 Inositol phosphate metabolism
    CpipJ_CPIJ002354
Enzymes [BR:cqu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CpipJ_CPIJ002354
Exosome [BR:cqu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CpipJ_CPIJ002354
  Exosomal proteins of bladder cancer cells
   CpipJ_CPIJ002354
  Exosomal proteins of melanoma cells
   CpipJ_CPIJ002354
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 6033672
NCBI-ProteinID: XP_001844098
VectorBase: CPIJ002354
UniProt: B0W5W4
AA seq 221 aa AA seqDB search
MGRKFCVGGNWKLNGDKASITELCKVLTTGPLNADTENCYKVAKGAFTGEISPAMLKDLN
IGWVILGHSERRAIFGESDELIADKIVHALAEGLKVIACIGETLQEREAGQTEAVCFRQT
KAIADKVKDWSNVVIAYEPVWAIGTGKTATPEQAQEVHAALRKWFTENVSADVSAAIRIQ
YGGSVTAANCRELAAKPDIDGFLVGGASLKPEFIQIVNARA
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtaagttctgcgttggaggcaactggaagttgaacggcgacaaggccagcatc
accgagctgtgcaaggtgctgacgaccggtccgctgaacgccgacaccgagaactgctac
aaggtcgccaagggtgccttcaccggtgagatctcgccggccatgctgaaggatctgaac
attggctgggtcatcctgggccactcggagcgtcgtgccatcttcggcgagtcggacgag
ctgattgccgacaagatcgtgcacgcgctggccgagggcctcaaggtgattgcctgcatc
ggtgagaccctgcaggagcgtgaggctggccaaaccgaggccgtttgcttccgccagacc
aaggccatcgccgacaaggtcaaggactggtccaatgttgtgattgcgtacgaaccagtg
tgggccatcggaaccggcaagaccgccaccccggaacaggcccaggaggtgcacgccgca
ctcaggaagtggttcacggagaacgtgtccgccgatgtgtccgcggcgatccgcatccag
tacggaggttccgtgaccgctgccaactgtcgcgagctggccgccaagcccgacattgac
ggattcctggtcggtggagcctcgctcaagccggagttcattcagattgtcaacgccaga
gcgtaa

DBGET integrated database retrieval system