KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002564Help
Entry
CpipJ_CPIJ002564  CDS       T01079                                 

Definition
ubiquitin specific protease
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CpipJ_CPIJ002564
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CpipJ_CPIJ002564
Peptidases [BR:cqu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CpipJ_CPIJ002564
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 862 aa AA seqDB search
MAHKKPLHMGKNLTDLEEHFKLGKTIGHKKVLQLCTAANRVKEYADRHYLDRDEEQAYVF
YMKYLNLISMIRNHGEYREKKQEILESLGNNSQMLVIYDKLEKLKDSLEQRYSRCGVVQE
RELNKQRNQQDNMTIIVTQQKLSINAKELLEMIRDSKTSMLIIDCRAEKDLQASGIRYDH
VVGVPVQLLVAGMTAGKIHEKLPPEDKPLWSSRKVKEQIVLMDYCTEGNLRKDTPLWVLN
DILNNWDQDVVYKKPFLKVEGGYKNFQLCYPMCCRNPSYVPSTMEFNDDARLEDIEYPNI
SEIRMKDDSFGSKPQPNRPAVDRNSKVAALHVYESKSKPITELLEEQEKLMDKSIQNERE
MLSTENVLKQIHDNQENVMDDNEKFEEISTLKYQLMQMEDKQKEFIAENTRLNEQVQEYK
IQEQSWRESGERISAREAELLELEAQRRIKEKADEQKRVEQERDRLARDRLAQERLEQRR
EEMLRIAYENKRRLPQQPPPVETNVEEPAAIRPKVPQFDRAAKPSANAGVSAAADYNQNV
YREVQRDFAPVYGSVGRGLTGLKNLGNTCYMNSILQCLSNTAFLREHFLEGTFRQNLNRS
NKTQGRIVEEVAAVIKALWLGQYKCIASKNLRYVVGQYERQFGGIEQQDSHEFLTILMDW
LHSDIQTVPIQQYSSLEDLSASEKAWIDYLKGMESYVSNLFYGQIKSTVKCVRCGKESAT
YESFSNLSLELPQNANRCHLNVSGFYADPEAVATVYKKKQNYVKFPLQELDMTTHIAPSE
LSRNKTLRARRYHLFGVSNHYGSMESGHYTAFCKNTVHQKWYKFDDHTVTSLDTSDVCSS
AGYILFYSSLPESPETQQHQIR
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atggctcacaagaaaccgcttcatatgggcaagaacctgacagatttggaggaacatttc
aagctagggaagacgatcggtcacaagaaggtgctgcagctatgtacggcggccaaccgc
gtcaaggagtacgccgaccggcattatttggaccgggatgaggagcaggcgtacgtgttt
tacatgaagtacttgaacctgatttcgatgatccggaaccacggcgagtatcgggagaag
aagcaagagattttggaatctctggggaacaactcccagatgttggttatttacgataag
ctggagaagcttaaggatagtctggagcagcggtacagtcggtgtggcgtggtccaggaa
cgggagctaaacaagcaacggaaccagcaggacaacatgacgattattgtgacccagcag
aagctttcgattaatgctaaagagctgttggagatgattcgggactcgaagacgagcatg
ctgatcattgactgtcgggcggagaaggacttgcaagcgtccggcattcggtacgatcac
gtggtgggcgttccggtgcagctgctggtggccggaatgacggccgggaaaattcacgaa
aagctgcctcccgaggacaaaccgctgtggtcatcgcgcaaggtgaaggaacaaatcgtg
ctgatggactactgcaccgagggaaacctccggaaggacactccgctgtgggtgttgaac
gacattctcaacaactgggatcaagatgtggtctacaagaaaccgttcctcaaggttgaa
ggaggctacaagaacttccagctgtgctatccgatgtgctgccgcaatccgtcctacgtc
ccgtcgacgatggagttcaacgatgatgcacggcttgaggacatcgagtatcccaacata
agcgagattcgaatgaaggacgatagctttggatcgaagccgcagccgaatcgaccggcc
gtcgatcggaacagcaaggtggccgcccttcacgtgtacgagagcaagagcaagccgatc
accgagctgctggaggagcaggaaaagctgatggacaaatccatccagaacgagcgcgaa
atgctttcgacggagaatgtgctgaagcagattcacgacaatcaggagaacgtcatggat
gacaacgaaaagtttgaggaaatcagcacgttaaagtaccaactgatgcaaatggaggac
aagcagaaggaatttattgccgagaacactagactgaatgaacaggttcaggagtacaag
atccaagagcagagctggagagaaagtggcgaacgcatctcggcacgcgaagccgaacta
ctggagcttgaagctcaacgaagaatcaaggaaaaagcggacgagcaaaagcgcgtcgag
caggagcgcgaccggctggcccgggaccgactcgcccaggagcggctcgagcagcggcgc
gaggaaatgctgcgaattgcgtacgaaaacaagcgccgcctcccgcagcagccgccgccg
gtggagactaacgtggaagagccagccgcgatccggccaaaggtgccgcagtttgatcgt
gcggcgaagccgtcggcaaatgctggagtgtcggcggcggcggattacaaccagaacgtg
taccgcgaggtgcagcgagactttgcgccggtgtacggcagcgtgggtcgcggcctgacg
gggctgaagaatctgggcaacacctgctacatgaacagcatactccagtgcctgagcaat
acggccttcctgcgggagcacttcctcgagggcaccttccggcagaatctcaacaggagt
aacaagacccaaggtagaatcgttgaagaggtggccgccgtcattaaagcgttatggctc
ggacagtacaagtgcatcgccagcaaaaacttgaggtacgtcgttggtcagtacgagcgc
cagtttgggggaatcgagcaacaagattcgcacgagtttctcaccattctaatggactgg
ctccactcggacatccagacggtgcccattcagcagtacagcagcttggaggacctgtcg
gcgtccgagaaggcgtggatcgactacctgaaaggcatggagagttacgtttccaacctg
ttctacggccaaatcaagagtacggtaaagtgcgtacgctgcggcaaggagagcgccacg
tacgagtccttctccaacctgagcctggaactgccccagaatgccaaccggtgccatttg
aacgtgagcggtttctacgccgacccggaggcggtcgcgacggtctacaaaaagaagcag
aactacgtcaagtttccgctgcaggagctcgacatgacgacccacattgccccgtccgag
ctgagccggaacaagacgttgcgcgcccgccggtaccacctgtttggtgtgtcgaaccac
tacggctcgatggagagcggccactatacggcgttctgcaaaaacacggtccatcaaaaa
tggtacaaatttgacgaccacaccgtgaccagcctcgacacgtcggacgtgtgctccagc
gctggctacatcctcttctactcatcccttccagagtcgccggagacgcagcagcaccag
attcgatag

DBGET integrated database retrieval system