KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002599Help
Entry
CpipJ_CPIJ002599  CDS       T01079                                 

Definition
uroporphyrinogen iii synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CpipJ_CPIJ002599
Enzymes [BR:cqu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CpipJ_CPIJ002599
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 267 aa AA seqDB search
MKKVVVLKSESDNSDTYSSLLQKHGFEPVLVPTLDFSFKNLDVLRDRLLSPYKYSGLIFT
SPRSITAVRDALGGQRLKDDWRTLENYSVGETSHDLICSHLQLNTKGQQSGNASNLADFI
KTDLYNKTITLPFLFPCGNLKQDVLQYKLSEYGYSLDSVEVYETVPHKDLERNLVQLFRG
DAPAFLLFFSPSGINYCSAIFERNKLDLGGCRIVAIGPSTKKAIENKGLTVYRTAEKPSP
DLTLNLYCVYMFYITSPLRNWLPAGDD
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggtggtcgtgttaaaatccgaaagcgacaacagtgacacctacagcagtctc
ctccagaagcatggcttcgagcccgtcctggtgccaactttggatttctcgtttaagaat
ttggacgttctgcgggatcgattactatcgccgtacaagtactccggcctaattttcacc
agtccgaggagtatcacagcggtgcgggatgcactgggtggacaacggttgaaggatgac
tggcggacgctggagaactacagcgttggggagacttcgcatgatttgatatgcagtcac
cttcagctgaacacgaagggtcagcagtcgggaaacgcaagcaatttggccgactttatc
aagacggacctgtacaacaaaacaataacgttgccgttcctgttcccctgcgggaacctc
aagcaagacgtccttcagtacaaactgtccgaatacgggtactcgctggactcggtcgaa
gtatacgaaacggtgccccacaaggacctggagcggaacctggtccagctgttccgcggt
gacgctccggcgttcctgctgttcttcagcccatccggcatcaactactgttcggccatc
ttcgagcggaacaagctggacctcggtggctgccggatcgtagccatcggccctagcacc
aagaaggccatcgagaacaaaggcctgacggtgtaccggacggcggaaaaaccctcgccc
gatcttaccctgaatctttactgtgtgtacatgttttacatcacgtccccgctcaggaac
tggcttccggcaggggacgactaa

DBGET integrated database retrieval system