KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002636Help
Entry
CpipJ_CPIJ002636  CDS       T01079                                 

Definition
kinase
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:cqu04310]
Environmental Information Processing; Signal transduction; Hedgehog signaling pathway [PATH:cqu04340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 416 aa AA seqDB search
MPEWGRLQHFKCLLTCRLTGSAGGNRCCLAASLRSEAMAEVKSAPTLKSYSPLKSSPSTQ
SSSRGAGGKKFSSTSDYKQTLNRLKVDFERRYQNPRVASESGLDDYDVLRTLGTGAFGVV
RLIRKKKSEEYFAMKIVSKERIIRQKQLQHMLNEKRILQSVEFPFLVTMESCYKDNSFIY
LAMPFVSGGELYSLLRKNKRFGEDQAKFYGAQVALAVEYLHHLGLIYRDLKPENILIDAK
GYVKITDFGFCKLIRDRTWTLCGTPEYLAPEIIQNKGYGKSVDWWSFGVLLYEMIAGYSP
FYTHSADQMLLFEKIVKGKVRFPSNFGTDIRNLIQSLVQVDLTKRFGNLKNGTSDIKQHA
WFRGTNWIGLLNGEVTAPFIPKVAGPGDTSQFDAYEEPPELMVTSKCLYVKEFADF
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgccagaatggggccgtctccagcacttcaaatgtctgctgacctgtcgcctcaccggt
agtgcgggaggaaacaggtgctgtctcgctgcgtccctccgttcggaagccatggccgag
gtcaagtcggccccgacgctgaaaagctacagcccgctcaagagttccccgtcgacgcag
tcgtcgtcccgcggggcaggaggtaaaaagttctccagcaccagcgactacaagcaaaca
ctgaaccggctcaaggtggactttgagcggcggtaccagaacccgcgggtggccagcgag
tccgggctggacgattacgacgtgctgcggacgctagggacgggcgcgttcggggttgtg
agattgatccgcaaaaagaaaagtgaggaatactttgcgatgaagatcgtgtccaaagag
cgaatcatccggcagaagcagttacagcacatgctgaatgagaagcggatcttgcagagc
gtcgagtttccgtttctggtgaccatggagagctgctacaaggacaacagttttatctac
cttgcgatgccgttcgtcagcgggggtgagctgtactcgttgctgcggaagaacaaacgc
tttggcgaggatcaggccaagttctacggggcgcaggttgccctggccgttgagtatctg
caccatctggggttgatctatcgcgatctcaagcctgagaacatcctgatcgatgcgaag
ggttacgtgaagatcacggactttggcttttgcaagttgatccgggatcgaacgtggacg
ctctgcggaacgcccgaatatctggcgccggagatcatccagaacaagggctacggcaag
agcgtcgattggtggtcctttggagtgctgctgtacgaaatgatcgcgggctactcgccg
ttttacacccactcggccgatcagatgttgctgtttgaaaagatcgtcaagggcaaggtg
cggttcccgtccaactttggcacggatatcaggaacttgatacagagtctggtgcaggtg
gatcttaccaagcggttcggcaacctgaagaacggcacgagtgacatcaagcagcatgcg
tggttccggggcaccaactggattgggctgctgaacggggaagtaacggcgccgtttatt
ccaaaagtggcaggtcccggcgacacgagtcagttcgatgcgtacgaggaaccgccggag
ctgatggtgacctcaaagtgtttgtatgtgaaagagtttgccgatttttaa

DBGET integrated database retrieval system