KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002636Help
Entry
CpipJ_CPIJ002636  CDS       T01079                                 

Definition
kinase
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    CpipJ_CPIJ002636
   04340 Hedgehog signaling pathway
    CpipJ_CPIJ002636
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CpipJ_CPIJ002636
Protein kinases [BR:cqu01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   CpipJ_CPIJ002636
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 416 aa AA seqDB search
MPEWGRLQHFKCLLTCRLTGSAGGNRCCLAASLRSEAMAEVKSAPTLKSYSPLKSSPSTQ
SSSRGAGGKKFSSTSDYKQTLNRLKVDFERRYQNPRVASESGLDDYDVLRTLGTGAFGVV
RLIRKKKSEEYFAMKIVSKERIIRQKQLQHMLNEKRILQSVEFPFLVTMESCYKDNSFIY
LAMPFVSGGELYSLLRKNKRFGEDQAKFYGAQVALAVEYLHHLGLIYRDLKPENILIDAK
GYVKITDFGFCKLIRDRTWTLCGTPEYLAPEIIQNKGYGKSVDWWSFGVLLYEMIAGYSP
FYTHSADQMLLFEKIVKGKVRFPSNFGTDIRNLIQSLVQVDLTKRFGNLKNGTSDIKQHA
WFRGTNWIGLLNGEVTAPFIPKVAGPGDTSQFDAYEEPPELMVTSKCLYVKEFADF
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgccagaatggggccgtctccagcacttcaaatgtctgctgacctgtcgcctcaccggt
agtgcgggaggaaacaggtgctgtctcgctgcgtccctccgttcggaagccatggccgag
gtcaagtcggccccgacgctgaaaagctacagcccgctcaagagttccccgtcgacgcag
tcgtcgtcccgcggggcaggaggtaaaaagttctccagcaccagcgactacaagcaaaca
ctgaaccggctcaaggtggactttgagcggcggtaccagaacccgcgggtggccagcgag
tccgggctggacgattacgacgtgctgcggacgctagggacgggcgcgttcggggttgtg
agattgatccgcaaaaagaaaagtgaggaatactttgcgatgaagatcgtgtccaaagag
cgaatcatccggcagaagcagttacagcacatgctgaatgagaagcggatcttgcagagc
gtcgagtttccgtttctggtgaccatggagagctgctacaaggacaacagttttatctac
cttgcgatgccgttcgtcagcgggggtgagctgtactcgttgctgcggaagaacaaacgc
tttggcgaggatcaggccaagttctacggggcgcaggttgccctggccgttgagtatctg
caccatctggggttgatctatcgcgatctcaagcctgagaacatcctgatcgatgcgaag
ggttacgtgaagatcacggactttggcttttgcaagttgatccgggatcgaacgtggacg
ctctgcggaacgcccgaatatctggcgccggagatcatccagaacaagggctacggcaag
agcgtcgattggtggtcctttggagtgctgctgtacgaaatgatcgcgggctactcgccg
ttttacacccactcggccgatcagatgttgctgtttgaaaagatcgtcaagggcaaggtg
cggttcccgtccaactttggcacggatatcaggaacttgatacagagtctggtgcaggtg
gatcttaccaagcggttcggcaacctgaagaacggcacgagtgacatcaagcagcatgcg
tggttccggggcaccaactggattgggctgctgaacggggaagtaacggcgccgtttatt
ccaaaagtggcaggtcccggcgacacgagtcagttcgatgcgtacgaggaaccgccggag
ctgatggtgacctcaaagtgtttgtatgtgaaagagtttgccgatttttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system