KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002644Help
Entry
CpipJ_CPIJ002644  CDS       T01079                                 

Definition
(RefSeq) 28S ribosomal protein S18b, mitochondrial
  KO
K16174  small subunit ribosomal protein S18b, mitochondrial
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Ribosome [BR:cqu03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    CpipJ_CPIJ002644
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S18
Motif
Other DBs
NCBI-GeneID: 6034395
NCBI-ProteinID: XP_001844713
VectorBase: CPIJ002644
UniProt: B0W7M9
AA seq 202 aa AA seqDB search
MSLLRALGSELFAAYRQGLTSGTSLRSFAVSSLRASTEKEAVEEDPGAEGETKSAAPVDD
PKDRTRVIPVETSIRYLASEAYQQTYQGEPVWKNYRRNHKGLYPPKQTRKTCVRKGKLST
GNPCPVCRDEYLVLDHQNVELLKQFVSPQTGKVLSYSITGLCQRKQLELKVAIDRAMDYG
LITFDVPFRDYDYAEYYAEKKQ
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtcattactcagagcgctcggaagtgaactgtttgccgcgtaccgccagggactgacc
tcaggaacgtcgctccgctcatttgccgtgtcctcgcttcgagcctccacagaaaaggaa
gcagtcgaggaagatcccggggcagaaggcgaaaccaagagtgccgccccggttgacgac
ccgaaagatcgcacccgggtgattccggtggagacgagcatccgctatttggcgagtgag
gcctaccagcagacttaccagggcgagccggtgtggaagaattacaggcggaaccacaag
gggctgtacccgccgaagcagacgcgcaagacgtgcgtgcggaagggcaagctttcgacg
gggaatccgtgcccggtgtgccgggacgagtacctggtgctggaccaccagaacgtggag
ctgctgaagcagtttgtgtcgccgcagacgggcaaggtgctgagctactcgataacgggg
ctgtgccagcggaagcagctggagttgaaggtggcgatcgaccgggccatggactacggg
ttgattacgtttgacgtgccgttccgggactacgattacgccgagtactacgcggagaag
aagcagtga

DBGET integrated database retrieval system