KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002644Help
Entry
CpipJ_CPIJ002644  CDS       T01079                                 

Definition
28S ribosomal protein S18b, mitochondrial
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Ribosome [BR:cqu03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    CpipJ_CPIJ002644
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 202 aa AA seqDB search
MSLLRALGSELFAAYRQGLTSGTSLRSFAVSSLRASTEKEAVEEDPGAEGETKSAAPVDD
PKDRTRVIPVETSIRYLASEAYQQTYQGEPVWKNYRRNHKGLYPPKQTRKTCVRKGKLST
GNPCPVCRDEYLVLDHQNVELLKQFVSPQTGKVLSYSITGLCQRKQLELKVAIDRAMDYG
LITFDVPFRDYDYAEYYAEKKQ
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtcattactcagagcgctcggaagtgaactgtttgccgcgtaccgccagggactgacc
tcaggaacgtcgctccgctcatttgccgtgtcctcgcttcgagcctccacagaaaaggaa
gcagtcgaggaagatcccggggcagaaggcgaaaccaagagtgccgccccggttgacgac
ccgaaagatcgcacccgggtgattccggtggagacgagcatccgctatttggcgagtgag
gcctaccagcagacttaccagggcgagccggtgtggaagaattacaggcggaaccacaag
gggctgtacccgccgaagcagacgcgcaagacgtgcgtgcggaagggcaagctttcgacg
gggaatccgtgcccggtgtgccgggacgagtacctggtgctggaccaccagaacgtggag
ctgctgaagcagtttgtgtcgccgcagacgggcaaggtgctgagctactcgataacgggg
ctgtgccagcggaagcagctggagttgaaggtggcgatcgaccgggccatggactacggg
ttgattacgtttgacgtgccgttccgggactacgattacgccgagtactacgcggagaag
aagcagtga

DBGET integrated database retrieval system