KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002650Help
Entry
CpipJ_CPIJ002650  CDS       T01079                                 

Definition
dolichol-phosphate mannosyltransferase
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:cqu00510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 239 aa AA seqDB search
MPENKYSILLPTYNEKDNLPIIIWLIVKYMQESKIDYEVIVIDDGSPDGTLEVAKQLQKI
YGEDRILLRPRASKLGLGTAYIHGIEHASGNYIIIMDADLSHHPKFIPQFIDLQKSNNLD
VVSGTRYSGAGGVYGWDFKRKLISRGANFLSQLLLRPNASDLTGSFRLYKKEVLKELISR
CKSKGYVFQMEMIVRARQLGYTVGEVPISFVDRVYGQSKLGGSEIVQFAKNLLILFATT
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgccagagaacaagtattccattttgcttcccacctacaatgagaaggacaatctaccc
atcattatctggttgattgtgaagtacatgcaagaatccaaaatcgattacgaggtgatc
gtcatcgacgatggcagcccggacggcacgctggaggtcgccaagcagctgcagaagatc
tacggcgaggaccgcattctactccgcccgcgggcctccaagttgggcctgggaactgcc
tacatccacggcatcgagcacgccagcgggaactacatcatcatcatggacgccgactta
agccatcaccccaagttcatcccgcagttcatcgacctccaaaaatcaaacaacctcgac
gtggtctccgggacgcgctacagcggcgccggtggcgtctacgggtgggactttaagcgc
aagctcatctcccgcggcgcaaacttcctgtcccagctgttgctgagaccgaacgcctcg
gacctgaccggatcgttccggctgtacaaaaaggaagtcctgaaggagctcatctcgcgc
tgcaagtccaaggggtacgtgttccagatggagatgattgtgcgggctcggcagctgggc
tataccgttggggaggttccgatttcgtttgtggatcgcgtgtacggacagagcaagctc
ggcgggtcggagattgtgcagtttgcgaagaatttgctgattttgtttgcgacgacgtag

DBGET integrated database retrieval system