KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002767Help
Entry
CpipJ_CPIJ002767  CDS       T01079                                 

Definition
single-strand selective monofunctional uracil DNA glycosylase
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    CpipJ_CPIJ002767
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     CpipJ_CPIJ002767
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 325 aa AA seqDB search
MLRKKLKLSDQPEPEPTTAGFDYAPMEFALRPQSLLPITSPHFEPKPQFAPQPQYQPELP
AIPSAVPLYYLPPVVPALPLWHRIYQLELQLCEALKQIPLPAEVAATYDPIQYAAELHLA
YMQRFLDRPKAVLFLGMNPGPWGMCQTGVPFGHVPSVRDWMQLRGQVYKPIGELEARPVQ
GLACTRGEQSGQRWWGLYEQLCGTPENFFRNCFVWNICPLAFFHSSGRNITPAELKGPAK
TRIQQVCNEFLKTALDLFNPVIIVSVGRYTEDRVKALVKQNLLDPNRVQLSCMPHPSPRS
LNNTNWLEKARQWLVDHGVMPYLQS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcaaaaagttgaaactgtccgaccagccggaaccggaacctaccaccgccggc
ttcgattacgctccgatggagtttgccctccgtccccagtcattactgcccataacttca
cctcatttcgagcccaagccacaattcgcaccacaaccacaataccaaccggaacttccg
gccattccgtcggctgtaccgctgtactacctacctccggtcgttccggcccttccgctg
tggcatcgcatctaccagctcgaactgcagctgtgcgaagcgctgaagcagattccactg
ccggcggaggtggccgccacgtacgatcccattcagtacgccgccgagctgcacctggcg
tacatgcagcgctttctggaccgtccgaaggcggtgctgttcctcggcatgaacccgggc
ccgtggggcatgtgccagaccggggttcccttcggacacgttccgtccgttcgggattgg
atgcaactgcgtggccaggtgtacaagccgattggggagttggaggcgcgtccggtgcag
ggattggcgtgcacccggggcgagcagagtggccaacgctggtggggattgtatgagcag
ctgtgtggtacaccggaaaacttcttccgaaactgcttcgtgtggaacatttgtccgttg
gcgttcttccactcgagcggacgaaacattacgccggcggagctgaagggcccggcaaaa
actcgcattcagcaggtctgcaacgagttcctgaagacggcgttggatctgtttaacccg
gtgatcatcgtgtccgttggtcggtacaccgaggatcgcgtgaaagccctggtcaagcag
aacctgctcgatccgaaccgggtgcagctcagctgcatgccccatccgagtccgcgaagc
ctcaacaacacaaactggttggagaaggctcgccagtggctcgttgaccacggggttatg
ccgtacctgcagtcttag

DBGET integrated database retrieval system