KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002874Help
Entry
CpipJ_CPIJ002874  CDS       T01079                                 

Definition
membrane-associated guanylate kinase
Orthology
K06091  
MAGUK p55 subfamily member 5
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Hippo signaling pathway - fly
Class
Environmental Information Processing; Signal transduction; Hippo signaling pathway -fly [PATH:cqu04391]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 841 aa AA seqDB search
MPQVPKHVNGGVSLELEPLDGFSDKNSSSLDSSNEFFKKNSSKGPSSLGSACESIGFDSI
NYLKNSRGSFSTRSSSSGDLGPPEYDIGPHRELPVDVPDSFVEQLNGSVKPIPPPRDHLR
IEKDGRLTNRAPVPAPQVPDRKLVPVTPPQLPHVAQVVEPTPDQLDSIKKFQEQLRRRRE
EEERIAAQNDFLRNSLRGSQRLRALQDNPVAADKPAIGVDNEAYADDEEPEKIIGYAELV
SALQRLQGHLNKHGLAALAGRVTAAQSLLLGPGIARALAARTAVLERRRPKVQNPICSNS
QALVKDCVESLAQSSSPAAIELCDLLSTYEMEGLLLAHDRIASTTDRTPAFGVSAASGAS
PVPRYGIPVVDPILGRLIKCIFSLQREPMSVPLGVLRDGSQDHIRIIQIEKSSEPLGATV
RNEGEAVVVGRVVRGGAAEKSGLLHEGDELLEVNGIEMRGKSVNDVCALLGAMSGTLTFL
VVTAGMPPMVPGMRDPPVLHVRAHFDYDPEDDLYIPCRELGISFQKGDVLHVISRDDPNW
WQAYREGEQDQTLAGLIPSQSFQHQRESMKLAIAGEVGLRTRKDANGKAGGSTLLCARKG
RKKKKKPSSEHGYPLYATATAEDPDPEEILTYEEVALYYPRASHKRPIVLIGPPNIGRHE
LRQRLMADSERFAAAIPHTSRPQREGEIPGQDYHFISRQQFESDILARKFVEHGEYEKAY
YGTSLEAIRAVVASGKICVLNLHPQSLKLLRSSDLKPYTVLVAPPSLEKLRQKRIRTGEP
YKEEELKEIIATARDMEARWGHLFDMIIINNDTERAYHQLLAEINSLEREPQWVPSSWLH
N
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaagtaccgaaacatgtaaacggaggagtctccttggagctggaacctcttgat
ggctttagcgataagaactcgtcctcgctcgacagtagcaatgagttcttcaagaaaaat
tccagcaaggggccgtcctcgctcgggtccgcctgcgagtcgatcgggttcgattcgatc
aattatttgaaaaactcaagaggttcgttcagtacaaggagctcctcgtcgggtgatctc
ggtccgcccgagtacgacatcggtccgcatcgtgagcttccagtagacgttccggatagt
tttgttgaacagctcaatgggtctgtaaaaccgattccacccccacgcgatcatctgcga
atcgagaaggatggccggctgacgaatcgagcgcccgttccggctccccaggttccggac
cggaagctcgtgcccgtgacaccaccccagcttccacacgtggcccaggtggtggaaccc
acgcccgaccagctggacagcatcaaaaagttccaggaacaactccgccgtcgacgagag
gaggaggagcgaatagccgcccagaatgactttctgcggaacagcctgcgtggctcccag
cggctgcgagcactgcaagataatccggtcgcggcggacaagcccgccatcggcgtggac
aacgaggcgtacgctgatgacgaggagccggaaaagatcatcggatacgctgagctggtg
tcggcactgcagcgattgcagggtcacctcaacaagcacggattggccgccctcgctggc
agagttacggccgcccagagtctgctgcttgggccgggtatagcgcgtgccctcgccgca
cgtacggccgtcctcgaaaggcggcgacccaaagtacagaaccccatttgctcaaattct
caggcactggtcaaggactgtgtcgaatccctggcgcaatccagttcgccggccgcaatt
gaattgtgtgatctactgtcgacgtacgagatggaggggttgctgctggcgcatgatcgt
atcgcgtccaccaccgaccggacaccggcgttcggcgttagtgcggccagcggtgcaagt
cccgtgccaaggtacggtatcccggtcgttgatccgatcctaggtcggttaatcaaatgc
atcttctctttgcagcgcgaacctatgagcgttccactgggtgtgttacgggacggcagt
caggaccacattaggataatacagatcgagaaatcttcggaaccactgggagcgaccgtt
cgcaacgagggtgaggccgtggtcgttggccgggtggtgcgtggtggagcagctgaaaag
tccggattgctgcacgagggtgatgagctgctcgaggtcaacgggatcgaaatgcgtggt
aaatccgttaacgacgtttgtgccctgcttggagccatgagtggaacgttgacgttcctc
gtggtgaccgccgggatgccaccgatggttccgggaatgcgcgatcctccggtgctgcat
gtgcgagcccatttcgactacgatcctgaggacgatctgtatattccgtgtcgtgagctg
ggcatcagctttcaaaaaggagacgttctgcatgtgatatctcgcgatgatccaaactgg
tggcaagcataccgcgagggcgaacaggaccaaactctcgccggtcttataccgagtcag
tcgttccaacaccaacgagagtcgatgaagcttgcgattgccggtgaggttggactccga
acgaggaaagacgccaacggaaaagcgggcggttcgacgcttctgtgtgctcgcaagggc
cggaaaaagaagaagaagcctagcagcgaacacggttacccgttgtacgcaacggcaacc
gccgaagatccggatccggaggagattctcacctacgaggaagtcgccctgtactatcca
cgtgcatcccacaaacgaccaattgtgctgattggtccacccaacatagggcggcacgag
ctgcggcaacgactgatggccgactccgaacgatttgcagctgccatacctcatacttca
aggccccagcgcgaaggtgaaatacccggacaagactatcactttatctcaaggcaacag
tttgaatcagatatactcgcgagaaagtttgtcgagcacggcgaatacgaaaaggcgtat
tacggtacttctctggaagccatccgtgccgttgtggccagtggaaagatttgcgtactg
aacctgcacccgcagagcctaaagctgctgcgatcatccgatctgaagccctacaccgtg
ctggttgcgccacccagtttggagaagcttcgccagaagcgaatacgaacgggtgaaccg
tacaaggaggaggaactgaaggaaatcatcgccacggcacgtgacatggaggcgcggtgg
ggccacttgttcgacatgatcatcatcaacaatgataccgagcgggcctaccatcaactg
ctggccgaaatcaactccctcgagcgggaaccacaatgggtgccaagtagctggctacac
aactaa

DBGET integrated database retrieval system