KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002898Help
Entry
CpipJ_CPIJ002898  CDS       T01079                                 

Definition
5'-AMP-activated protein kinase catalytic subunit alpha-2
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:cqu04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:cqu04150]
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:cqu04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 547 aa AA seqDB search
MADKSTGTVQPLVKIGHYVLGATLGCGTFGKVKIGEHQLTKHKVAVKILNRQKIKSLDVV
GKIRREIQNLKLFRHPHIIKLYQVISTPTDIFMIMEYVSGGELFDYIVNNGKLQESEARR
FFQQIISGVDYCHRHMIVHRDLKPENLLLDHNRHVKIADFGLSNMMLDGEFLRTSCGSPN
YAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKIKSGIFPIPEYLN
KQVVSLLCQMLQVDPLKRATVEEIKKHEWFQKDLPAYLFPSPVEQDSSVIDTHAVTEVCD
KFGVKEQEVHNALLSGDPHDQLAIAYHLIIDNKRIADEAAKAELKDFYVAGSPPPAPPMP
EKPTPSNNEPFKSPSIHPERIAPLRERAVTVGSAPIPSPNITATAIPVDKHRATGTPVKR
AKWHLGIRSQSKPNDIMLEVYRAMKALDFEWKIINPYHVRVRKQNARNDKFVKMSLQLYQ
VDAKSYLLDFKSLTNEEVEQGDDVIMESLTPPPPVGFGGMGMPNQPTGHHTMEFFEMCAA
LIIQLAR
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggcggacaaaagcacgggaactgtgcagccgctggtaaaaattggccactatgtactg
ggagcaacgctgggctgtggaacatttggcaaggttaaaatcggagagcaccaactaacg
aagcacaaagtggcggtgaagatcctgaaccgacagaaaattaaaagcctggacgtggtt
ggcaagatccgccgtgagatccagaatctcaagctgttccgccacccacacatcatcaag
ctgtatcaggtgatttctacgccgaccgatatatttatgatcatggagtacgttagcggc
ggagagctgtttgattatattgtgaataacggcaagttgcaggaatcggaagcgaggcga
ttcttccagcagatcatctccggtgtcgactactgtcatcgccacatgatcgtgcatcgc
gacttgaagccggagaatctactactggaccataatcgtcacgtaaagattgccgatttc
ggactctcgaacatgatgctggacggagagtttctacgcacatcttgtggatcgcccaac
tacgctgctccagaggttatttccggcaaactgtacgccggaccggaggtggacatctgg
tcctgcggagttattctttacgcgttgctttgtggaacacttcccttcgatgatgagcat
gtgccgacgctgttccgaaagatcaagtctggaattttccccattccggagtacctgaac
aagcaggtggtcagcttgctctgccagatgttgcaggtcgatccactaaagagagccacc
gttgaggagatcaaaaagcacgaatggttccagaaggatttgccggcgtacctgtttccg
tctccggtcgaacaggacagcagcgttatcgatacgcatgccgttacggaagtgtgcgac
aaatttggcgtaaaggaacaggaagtgcacaacgctctgttgagtggtgatcctcacgat
cagctagctatcgcgtaccatttgatcatcgacaacaaacgcatcgcggacgaagcggcc
aaggcagagttgaaggatttctacgtcgccggaagtccgccgccggcaccgcctatgccg
gaaaagcctacaccaagcaacaacgagccatttaaatcgccatcaattcatccggaacgt
atcgccccgttgagggaacgcgccgtcaccgttggcagtgcccccattccttctccaaac
ataacggcgacagccattccggtggacaaacaccgtgcaaccggaactccggtaaaacga
gccaagtggcatctgggcattagatcgcaatcgaaaccgaacgacatcatgcttgaagtt
tatcgcgccatgaaggctcttgattttgagtggaaaatcatcaatccgtatcatgtgcgg
gttcgcaaacaaaacgcccgcaacgacaaatttgtcaaaatgtcccttcagctgtaccaa
gtcgacgcgaaaagttatttgctggatttcaaatccctcaccaacgaagaggtcgagcag
ggtgatgacgtgatcatggaaagcctaacgccaccgcccccggttggcttcggtgggatg
ggcatgcccaatcaacccacgggacaccacacgatggaattttttgaaatgtgcgcagcc
ctaatcatccagctggctcgttaa

DBGET integrated database retrieval system