KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002898Help
Entry
CpipJ_CPIJ002898  CDS       T01079                                 

Definition
5'-AMP-activated protein kinase catalytic subunit alpha-2
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    CpipJ_CPIJ002898
   04150 mTOR signaling pathway
    CpipJ_CPIJ002898
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    CpipJ_CPIJ002898
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CpipJ_CPIJ002898
Protein kinases [BR:cqu01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   CpipJ_CPIJ002898
Mitochondrial biogenesis [BR:cqu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    CpipJ_CPIJ002898
  Mitophagy factors
   Other mitophagy factors
    CpipJ_CPIJ002898
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 547 aa AA seqDB search
MADKSTGTVQPLVKIGHYVLGATLGCGTFGKVKIGEHQLTKHKVAVKILNRQKIKSLDVV
GKIRREIQNLKLFRHPHIIKLYQVISTPTDIFMIMEYVSGGELFDYIVNNGKLQESEARR
FFQQIISGVDYCHRHMIVHRDLKPENLLLDHNRHVKIADFGLSNMMLDGEFLRTSCGSPN
YAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKIKSGIFPIPEYLN
KQVVSLLCQMLQVDPLKRATVEEIKKHEWFQKDLPAYLFPSPVEQDSSVIDTHAVTEVCD
KFGVKEQEVHNALLSGDPHDQLAIAYHLIIDNKRIADEAAKAELKDFYVAGSPPPAPPMP
EKPTPSNNEPFKSPSIHPERIAPLRERAVTVGSAPIPSPNITATAIPVDKHRATGTPVKR
AKWHLGIRSQSKPNDIMLEVYRAMKALDFEWKIINPYHVRVRKQNARNDKFVKMSLQLYQ
VDAKSYLLDFKSLTNEEVEQGDDVIMESLTPPPPVGFGGMGMPNQPTGHHTMEFFEMCAA
LIIQLAR
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggcggacaaaagcacgggaactgtgcagccgctggtaaaaattggccactatgtactg
ggagcaacgctgggctgtggaacatttggcaaggttaaaatcggagagcaccaactaacg
aagcacaaagtggcggtgaagatcctgaaccgacagaaaattaaaagcctggacgtggtt
ggcaagatccgccgtgagatccagaatctcaagctgttccgccacccacacatcatcaag
ctgtatcaggtgatttctacgccgaccgatatatttatgatcatggagtacgttagcggc
ggagagctgtttgattatattgtgaataacggcaagttgcaggaatcggaagcgaggcga
ttcttccagcagatcatctccggtgtcgactactgtcatcgccacatgatcgtgcatcgc
gacttgaagccggagaatctactactggaccataatcgtcacgtaaagattgccgatttc
ggactctcgaacatgatgctggacggagagtttctacgcacatcttgtggatcgcccaac
tacgctgctccagaggttatttccggcaaactgtacgccggaccggaggtggacatctgg
tcctgcggagttattctttacgcgttgctttgtggaacacttcccttcgatgatgagcat
gtgccgacgctgttccgaaagatcaagtctggaattttccccattccggagtacctgaac
aagcaggtggtcagcttgctctgccagatgttgcaggtcgatccactaaagagagccacc
gttgaggagatcaaaaagcacgaatggttccagaaggatttgccggcgtacctgtttccg
tctccggtcgaacaggacagcagcgttatcgatacgcatgccgttacggaagtgtgcgac
aaatttggcgtaaaggaacaggaagtgcacaacgctctgttgagtggtgatcctcacgat
cagctagctatcgcgtaccatttgatcatcgacaacaaacgcatcgcggacgaagcggcc
aaggcagagttgaaggatttctacgtcgccggaagtccgccgccggcaccgcctatgccg
gaaaagcctacaccaagcaacaacgagccatttaaatcgccatcaattcatccggaacgt
atcgccccgttgagggaacgcgccgtcaccgttggcagtgcccccattccttctccaaac
ataacggcgacagccattccggtggacaaacaccgtgcaaccggaactccggtaaaacga
gccaagtggcatctgggcattagatcgcaatcgaaaccgaacgacatcatgcttgaagtt
tatcgcgccatgaaggctcttgattttgagtggaaaatcatcaatccgtatcatgtgcgg
gttcgcaaacaaaacgcccgcaacgacaaatttgtcaaaatgtcccttcagctgtaccaa
gtcgacgcgaaaagttatttgctggatttcaaatccctcaccaacgaagaggtcgagcag
ggtgatgacgtgatcatggaaagcctaacgccaccgcccccggttggcttcggtgggatg
ggcatgcccaatcaacccacgggacaccacacgatggaattttttgaaatgtgcgcagcc
ctaatcatccagctggctcgttaa

DBGET integrated database retrieval system