KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ003116Help
Entry
CpipJ_CPIJ003116  CDS       T01079                                 

Definition
beta-1,3-Galactosyltransferase
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    CpipJ_CPIJ003116
Enzymes [BR:cqu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     CpipJ_CPIJ003116
Glycosyltransferases [BR:cqu01003]
 Glycan extension
  Type 3 chain
   CpipJ_CPIJ003116
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 405 aa AA seqDB search
MTHAQLFCVRNHGHPRTLVTLIFGTVLGFMFATFITSSTSNRAPWLPEYYHSKDAAPPIV
SDPHTGHDLRDAAGPEQDVGFHGEHEEAHAHENSSLASQLYREVRVLCWIMTNPSNHKKK
ALHVKRTWGSRCNKLVFMSSTADPLLDSVPLPVKEGRDNLWAKTKEAFKYIYQHHLDDAD
WFIKADDDTYVVLENLRYMLYPYSPSIPIYFGCKFKPFVKQGYMSGGAGYVLSKTAVKRF
VEEAIPNKNCRQDNDGAEDVEMGKCMELVKVLAGDSRDSLGRGRFFPFVPEHHLIPNHVD
KNFWYWKYIYYKTDEGLDCCSDNAISFHYVSPNQMYVLDYLVYHLRPYGIVAHSQPLPKK
QSLADVVQTDDLSKTTEKSPQQPGQDGEATETKEKREVEDNLLLE
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgcacaactcttctgtgtccgcaaccatggccatccgcgaacgctggtcacc
ctaatcttcggcacggtgctcggctttatgttcgcaacctttatcacttcgagcacgtcg
aatcgtgcgccgtggctgccggagtattaccactccaaggacgctgcgccaccgatagtg
agtgatccgcacacggggcacgacctgcgggatgctgcggggccggaacaggacgtgggt
ttccacggtgagcacgaggaggcccacgcgcacgagaacagctcgctcgccagtcaactg
tacagggaggtgcgcgttctgtgctggatcatgaccaatccgagcaatcacaagaagaaa
gcgctgcacgtgaaacgtacgtggggctcgcggtgcaacaagctggtctttatgagctcg
actgcagacccacttctcgactcggtgccgctgccagtgaaggaaggccgtgataacctt
tgggccaagacgaaggaagccttcaagtacatttaccagcatcatctggacgatgccgac
tggttcatcaaggcggatgatgacacctacgtagtgctagaaaaccttagatatatgctg
tacccgtactcgccgagcatcccgatctactttgggtgcaagtttaagccgttcgtcaag
cagggctacatgtccggtggggcgggctacgtcctcagcaagacggccgtgaagcgcttt
gtcgaggaagctatcccgaacaagaactgccggcaggacaatgatggcgcagaggatgtc
gaaatgggcaaatgtatggaattggtcaaggtgcttgcgggagactcccgagactccctt
ggtcggggtcgattcttcccgtttgtcccggaacatcatttgattccgaaccacgtggac
aaaaatttctggtactggaagtacatttactacaaaactgatgagggtctcgactgctgc
tcggacaacgccatctcgttccactacgtgtcgcccaaccaaatgtacgtactagactat
ctggtgtaccacctgcggccgtacggaatcgttgcccactcgcagccgctgccgaagaag
caatcgctagcggacgtggtccagacggacgatctcagcaaaacgacggaaaagagtccg
cagcagccggggcaagacggagaagcgacggaaaccaaagaaaaacgcgaggtggaggat
aatttactgctcgaatag

DBGET integrated database retrieval system