KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ003198Help
Entry
CpipJ_CPIJ003198  CDS       T01079                                 

Definition
neuropathy target esterase/swiss cheese
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:cqu00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1283 aa AA seqDB search
MDIVGLVKRSYSDYGTILKDSWYTIIAEELRENFAWSLSLLLLFIATIFGLYCWRRIYLK
KLRDKAAQLLFQNYDSSQLRFRKRDKMMFYGRRMLRKMKSISGQAYGGQGRKRKAVMRFA
KRLLHMRRDNDPIQLQVVEPPAEYLEEAAEGNDKVPPDALYMLQSIRIFGHFEKPVFLKI
CKHTEIINLIAGESLIKVGDADDSVFIVQSGQINVFLNNPDGSSIALKVVRKGESVTSLL
SFIDVLVGNTSQYKTVTARAMENSQVIRLPMFAFKEVFDESPDLLVRVIQVIMIRLQRVT
ITALHNYLGLSTEYIQCSSQRKKVSVPMKNSPGHRRVPSDVQIQPSHSLVGQLSSASEIR
PDMLADLADHIASRRTSALPSEPMEEALMKSIAIEGFLKELGLREEDRPFIEDNIVLKEI
APGTTLTHQARSDDVMLIFVISGGLTLAQYPQINPGCNKKLDKSDSHTVTIHPGDVVGGL
AVLTGESSLYTIKAKHYSRVGLLSKEVIYSIMRERPAVVLDIADSVVKRLSPLVRQCDFA
LDWNFLESGRAVYRQDETSDCTYIVLNGRLRSVITHTNGKKEIVGEYGKGDLIGIVEMIT
ETSRTTTVMAVRDSELAKLPEGLFNAIKFKYPIVVTQLISLLSHRILGSMQSRSITGSAL
TTVPFDTNQQILHRYSTVAIVGISEDVPLTAFTYELYHSLCAIGSTLRLTSEVVRKTLGP
QIMEQSNEYRLTSWLGQQEDRHNIALYQCDLTFGPWTQRCLRQADVILIVGVGDRPPTIG
KLEKEIDRLAIRTAKELVLLHHEGAARPSNTTSWLNMRAWVTRHHHIQCPKRMFTRRSQY
RINDLYSKVLMSEPNIHSDFSRLARWLTGNSVGLVLGGGGARGAAHVGMFRAIQEAGIPI
DMVGGVSIGAFMGALWCSEKNITTVTQKAREWCKKMTQWGRQLLDLTYPITSMFSGRDFN
QTIHGTFGDVCIEDLWIPYFTLTTDISASCARTHTHGSLWRYVRSSMSLSGYMPPLCDPK
DGHLLLDGGYVNNLPADVMRGQGAAHIIAIDVGSQDDTDLTDYGDDLSGWWLLYKRWNPF
TSPVKVPNLPDIQSRLAYVSCVRQLEEVKKSDYCEYIRPPIDTYKTLAFGSFDEIKNVGF
EHGKAFFENMAKCGRLSRFNQWSVKDVPQKVTHSLNEYSFIDLAQIVCKVPETYPERGYS
SSEDDYYDGYASEPSTIPMNKGSSMRIMRAAGSLSLSENEMDSDELEYPVAFKKLQSPTP
TSERNISNNSSSIPLTPERSFKD
NT seq 3852 nt NT seq  +upstreamnt  +downstreamnt
atggacatcgtcgggctggtcaagcggtcgtactccgattacggaactatcctgaaggac
tcgtggtatacgataatcgcagaagagcttagagaaaattttgcctggtcattgagctta
cttttgctctttattgccacgatttttggcctgtactgctggagacgcatctacttgaaa
aaactgcgcgacaaggccgcccagctgctgttccagaactatgactcgtcccagctgcgc
tttcgcaagcgcgacaagatgatgttttacggccggcggatgctgcgcaagatgaagtcc
atctcgggccaggcgtacggcgggcagggccgcaagcggaaggccgtgatgcggttcgca
aagcggctgctacacatgcgccgcgacaacgacccgatccagttgcaggttgtggaaccg
ccggccgagtatctggaggaagcggccgagggcaacgacaaggttccaccggatgcgctg
tacatgctgcagagcatacgcatttttggtcactttgagaagccggttttcttgaagatt
tgcaagcacaccgagattataaatttaattgcgggtgagtcgctgatcaaggttggtgac
gcggatgatagcgtgtttatcgtgcagtcaggacagatcaatgtgtttctgaataatcca
gacggaagttcgattgcgttgaaggtggttcgtaagggtgagtcggtgacgtcgttgttg
agctttatcgatgtgcttgtgggcaatactagtcagtacaaaacggtgaccgcaagggcc
atggagaactcgcaggtcatccggttgcccatgttcgccttcaaggaggtgtttgacgaa
agtccggacctgttggttcgggtgattcaggtcatcatgattcgattgcagcgggtcacg
atcacagcgctgcacaattatcttggactgagcacggagtacattcagtgttcctcacaa
cgcaagaaggtttccgttccgatgaagaacagtcccggccatcggcgcgttccttcggac
gtccagattcagccgtcgcattcgttggttggccagctgagcagtgccagcgagatccgg
ccggacatgttggccgatttggccgatcacattgccagccggcggacgtcggccctgccg
agtgaaccgatggaggaagcgctgatgaagtctatcgccattgaggggttcctcaaggag
ctgggtctgcgggaggaagaccggccttttatcgaggacaacattgtgcttaaggagatt
gcaccggggacaacgcttacgcaccaggccagaagtgatgacgtcatgctgatattcgtc
atcagtggcggattgacacttgcccagtatccgcaaatcaatcccgggtgcaacaaaaag
ttggacaagtccgatagtcacacagttaccatccatccgggtgatgtcgttggaggattg
gccgttttgacgggcgaaagcagtttgtacacgatcaaagccaagcactattcgcgggtg
ggactgctaagcaaggaagtgatctacagcataatgcgggaacgcccagccgtagtgctg
gatattgccgatagcgtcgtgaagcgtttgtcgcctctggttcggcagtgtgattttgca
ctggattggaactttttggagtctggtcgggcggtttatcgccaggatgagaccagcgat
tgcacgtacatcgtgctgaatggccgtcttcggtcagtcatcactcacacgaacggcaag
aaggagattgtaggcgaatacggcaaaggagacttaattggaatcgtcgaaatgatcacg
gagacgtcccgcaccacaaccgtgatggccgtcagagattccgagctggcaaagctgccg
gaaggtctgttcaacgcgatcaaattcaagtatccaatcgtagtgactcagctgatcagt
ttacttagccatcgcatcctgggatcgatgcagtctcgatcaattaccgggagcgcgttg
acgacagttccgttcgatacgaatcagcaaattttgcatcgttactctacggttgcgatc
gtcggcatcagcgaggacgtgccgctgaccgcgttcacatacgagctataccactctctc
tgtgccatcggttcaacgctgaggttgacctcggaggtggtgcgcaaaacccttggtccc
cagatcatggaacaatccaacgaatatcggttgaccagctggcttggccagcaggaggat
cggcacaacattgcgctgtatcagtgcgatctcacgtttggtccgtggacgcagcgttgc
ctgaggcaggctgacgtaattctgatcgtcggtgtcggtgatcgtccgccaacgatcggt
aagctcgagaaggagattgaccggctggcgatcaggacggccaaagagttggtcctgttg
caccacgagggcgctgcccgaccgagcaacacgaccagttggctcaacatgcgggcctgg
gtgacgcggcatcatcacatccaatgtcctaagcgcatgtttacgcgacgtagtcagtac
cgcattaacgacttgtacagcaaggtgctcatgtccgaaccgaacatccactcggacttt
tcgcggctggcccgatggttgacgggaaattcggttgggttggtgcttggcggaggtggc
gcacgaggagcggcccacgtgggtatgttccgcgcgattcaggaagccggaattccgatc
gacatggtgggcggcgtcagcatcggtgcctttatgggtgccctctggtgttcggagaaa
aacatcactacggtcacgcaaaaggccagggagtggtgcaagaaaatgacccagtggggt
cgtcagctgctggacctgacctatcccatcacgtcaatgttctccggcagagatttcaac
caaaccatccacgggaccttcggggacgtttgcatcgaggacctgtggattccgtacttt
acgcttaccaccgacatttcagctagctgcgcgcggacgcacactcacgggtccctctgg
cgttatgttcgatcgtccatgtcgcttagcgggtacatgcccccgctgtgtgatccgaaa
gatggacatctgctcttggacggcggttatgtgaataacctaccagcggatgtgatgcgt
ggccagggtgcagcccacataattgcgatcgacgttggctcgcaagacgacaccgacctg
acggactacggcgacgacctgtccggctggtggctgctgtacaaacgctggaacccgttc
acgtcacccgtcaaggtgcccaacctgcccgacattcagtcccggcttgcgtacgtttcc
tgcgtccggcagttggaggaagtgaagaaaagcgattactgcgagtacatccggccaccg
atcgatacctacaagacgctggcgtttggaagtttcgacgagatcaaaaacgttggcttc
gagcacggaaaggccttcttcgaaaacatggccaaatgtgggcgcctgtcgcgattcaac
cagtggagcgtcaaggacgttccccagaaggtgacgcactctctgaacgaatactccttc
atcgatttggcccaaattgtgtgcaaagtgccggagacgtacccggagcggggttactcg
tccagcgaggacgactactacgacggttacgcgtccgaaccgtccaccatcccgatgaac
aagggctcgtcgatgcggatcatgcgggccgccggttcgctgtcgctgtccgagaacgag
atggactcggacgagctcgaatatccggtggcgttcaaaaaacttcagagtccaacgccc
acgtccgagcgaaacatcagcaacaatagcagcagcattccgctgacaccggagcggtcg
ttcaaagattga

DBGET integrated database retrieval system