KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ003218Help
Entry
CpipJ_CPIJ003218  CDS       T01079                                 

Definition
ubiquitin carboxyl-terminal hydrolase 22
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CpipJ_CPIJ003218
Peptidases [BR:cqu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CpipJ_CPIJ003218
Transcription machinery [BR:cqu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CpipJ_CPIJ003218
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 546 aa AA seqDB search
MSDHGCAHFGAFVKEYGLEPFSVVHAYFSVCINKEARRRKALSCLCFKCGGSGPQLYSCL
HCIYFGCKGAHIGEHCKQTKHYIVLELSYGMIYCHQCKDFIYDAECQAIAEKHIKKEAKS
LNKSLSWRPWSPSKLEIDLLLKNPKRRHVTAVTSIGLRGLLNLGSTCFMNCIVQALIHTP
LLRDYFLSERHECTAKTAAKCLVCEVSRLFQEFYSGARGPLSLHRLLHLIWNHARHLAGY
EQQDAHEFFIATLDVLHRHCKISMTEMAAAAAAAAEKSNKPHQPPPPPPHQDSNPTQCNC
IIDQIFTGGLQSDVVCQACNGVSTTIDPFWDISLDLGEAQNQGYGGPPKSLIDCLERFTR
AEHLGSSAKIKCSTCKSYQESTKQLSMRTLPIVASFHLKRFEHSSLIDKKISTFISFPAE
LDMTPFMSKKKSDQSNPSTSSTSSSSHSSKSKSSDRKQQHQQAQQSNDEATAAAATDASG
DFRYSLYAVINHVGTLDAGHYTAYVRHQKDIWVKCDDHIITTATLKQVLDSEGYLLFYHK
KVLEYE
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaccacggatgtgcccacttcggggcgttcgtgaaggagtacgggctggagccg
ttcagcgtggtgcacgcgtactttagcgtgtgcatcaacaaggaggcccgccggcggaag
gccctgtcctgtttgtgcttcaagtgtggcggttccgggccgcagctgtactcgtgtctg
cactgtatctactttggctgcaagggggcgcacatcggggagcactgcaagcaaacaaag
cactacatcgtgctggaactgagctacggaatgatttactgccaccagtgtaaggacttt
atctacgacgccgagtgccaggccatcgccgagaagcacatcaagaaggaagcgaaaagt
ctcaacaagagtctctcgtggcggccctggtcgccgtccaagctggagattgacttgctc
ctgaagaacccgaagcgacggcacgtgacggccgtgaccagcatcggccttcgtgggctg
ctcaacctcggctcgacctgcttcatgaactgcatcgtccaagcgttgatccacacgccc
ctgctgcgggactatttcctatccgaacggcacgagtgcaccgccaagaccgctgccaaa
tgtctcgtctgtgaagtgtcccgtctcttccaggagttttactccggcgcccgtggccca
ctctccctgcaccgtctgctgcatttaatctggaaccacgcgcgacacctcgccggctac
gaacagcaggacgcgcacgagtttttcatcgccacgctggacgtgctccaccggcactgc
aaaatctcgatgaccgaaatggcagcggccgccgccgcagccgcagaaaagtcgaacaaa
cctcaccaaccacctccgccaccaccccaccaggacagcaacccgacccagtgcaactgc
atcatcgaccagatcttcaccggtggcctccaaagtgacgtggtctgtcaggcctgcaac
ggcgtctccaccaccatcgatcccttctgggacatttcgctcgaccttggggaggcccag
aaccagggctacggagggccgcccaagtcgctcatcgactgcctcgagcggttcacgcgg
gccgaacatctcggctcgagcgccaaaatcaaatgttccacctgcaagagctaccaggaa
tcgacgaagcagctgtcgatgcgcaccctgccgatcgtggccagcttccacctgaagcgg
ttcgaacactctagtctgattgacaagaagatctccaccttcatctcattcccggccgag
ctggacatgactccgttcatgtcgaaaaagaagtctgaccagtccaacccttccacctcc
tccacctcttcctcatcccactcttcaaagtctaaatcctccgaccggaagcagcaacat
cagcaggcgcaacaatccaacgacgaagccacggcggcggcggcgacggacgcatccgga
gactttcggtactcgctgtacgccgtcatcaaccacgtggggacgctggacgcgggccac
tacacggcgtacgtgcgccaccagaaggacatttgggtcaagtgcgacgaccacatcatt
acgactgccacgctcaagcaggtgctggatagtgagggctatctactgttttaccacaaa
aaggttctggagtatgagtag

DBGET integrated database retrieval system